KEGG   Mus musculus (mouse): 21754Help
Entry
21754             CDS       T01002                                 

Gene name
Tesk1, AI326901
Definition
testis specific protein kinase 1 (EC:2.7.12.1)
Orthology
K08841  
testis-specific kinase 1 [EC:2.7.12.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     21754 (Tesk1)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: TKL group
  LISK family [OT]
   21754 (Tesk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4; 4 A5-C1
AA seq 627 aa AA seqDB search
MAGERPPLRGPGPGEAPGEGPGGAGGGPGRGRPSSYRALRSAVSSLARVDDFDCAEKIGA
GFFSEVYKVRHRQSGQVMVLKMNKLPSNRSNTLREVQLMNRLRHPNILRFMGVCVHQGQL
HALTEYMNGGTLEQLLSSPEPLSWPVRLHLALDIAQGLRYLHAKGVFHRDLTSKNCLVRR
EDRGFTAVVGDFGLAEKIPVYREGTRKEPLAVVGSPYWMAPEVLRGELYDEKADVFAFGI
VLCELIARVPADPDYLPRTEDFGLDVPAFRTLVGNDCPLPFLLLAIHCCSMEPSTRAPFT
EITQHLEQILEQQPEATPLAKPPLTKAPLTYNQGSVPRGGPSATLPRPDPRLSRSRSDLF
LPPSPESPPSWGDNLTRVNPFSLREDLRGGKIKLLDTPCKPATPLPLVPPSPLTSTQLPL
VTTPDILVQPETPVRRCRSLPSSPELPRRMETALPGPGPSPMGPTEERMDCEGSSPEPEP
PGLAPQLPLAVATDNFISTCSSASQPWSPRSGPPLNNNPPAVVVNSPQGWAREPWNRAQH
SLPRAAALERTEPSPPPSAPREPEEGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLNC
EAGSLLCHRGHHAKPPTPSLQLPGARS
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggccggggaacggccgccgctgcggggccccgggcccggagaggctccgggggagggg
ccggggggcgcaggcggaggcccgggccggggccggccctcctcctaccgggccctccgc
agcgccgtgtccagccttgcgcgtgtggacgatttcgactgcgcagagaagatcggggcc
ggtttcttctctgaggtctacaaggttcggcaccgacagtcgggacaagtcatggtgctg
aagatgaacaagctccccagtaaccggagcaacacgctaagggaggtgcagctgatgaac
cggctccggcaccctaacatcctcaggttcatgggggtctgtgtgcaccaagggcagctg
cacgcgcttacagagtatatgaatgggggcaccctggaacagctgctcagctccccagaa
cccctctcctggccagtcaggctccacctagccctggacattgcacaaggcctacggtac
ctacacgccaaaggtgtgtttcaccgagacctcacatccaagaactgtctggtccgaagg
gaagaccgaggcttcacagctgttgtgggtgacttcggactggctgagaagattcctgtg
tatagggaagggacaaggaaggagcccttggctgtggtgggctccccgtactggatggct
ccagaggtgttgcggggagagctgtatgatgagaaggccgatgtcttcgccttcgggatc
gtcctctgtgagctcatcgcccgagtgcctgcagaccctgactacctaccccgcactgag
gactttggcctggatgtgcctgctttccgaactttggtgggaaatgactgtccgctacct
ttcctgcttctggccatccactgctgcagcatggaacccagcacccgggccccttttact
gaaatcacccagcacctggaacagatcctggagcagcagcctgaggccacgcccctcgcc
aagccacccctcaccaaggctcccttgacatacaatcaggggtctgttccaagaggaggt
ccctctgccacacttcccaggccagacccccggctctcccgaagccggtcagacctcttc
ctgccaccttcgccagaatcaccccccagctggggggacaatctaacacgagtcaacccc
ttctcactgcgggaagacctcaggggtggcaagatcaagctgctggacacaccctgcaag
ccggccactccactgcccctggttccaccatcaccacttacctctacccagctgccctta
gtgaccactccagacatcctggtccagcctgagacccctgtccgccgctgtcgctcacta
ccttcatcccctgagcttccccgacggatggagactgcactgccaggtcctggcccttcc
cccatgggcccgactgaggagaggatggactgcgagggcagcagccctgagccagagccc
ccaggcctggctccccagctgcctctggctgtggccactgacaacttcatcagtacttgt
tcctcagcctcgcagccctggtctcctagatcaggacctcccctcaacaataatccccct
gctgtggtggtgaattccccacaagggtgggctagggagccctggaaccgggcacagcat
agccttccccgggcagcagccctggagcggacagagccctcaccgcccccatcagctccc
cgggagccggaggaggggctgccctgccctggctgctgccttggcccgttcagctttggc
tttctatccatgtgcccccgccctaccccagctgttgcccgctaccgcaacttgaactgt
gaggcgggcagtcttctctgccaccgagggcatcatgccaagccacccacacccagcctg
cagctgcctggggcacgctcttag

DBGET integrated database retrieval system