KEGG   Mus musculus (mouse): 217578Help
Entry
217578            CDS       T01002                                 

Gene name
Baz1a, Acf1, B930060C03, BC065123, Gtl5, Wcrf180, cbp146
Definition
(RefSeq) bromodomain adjacent to zinc finger domain 1A
  KO
K11655  
bromodomain adjacent to zinc finger domain protein 1A
Organism
mmu  Mus musculus (mouse)
Brite
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Chromatin remodeling factors
   CHRAC complex
    217578 (Baz1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
12; 12 C
AA seq 1552 aa AA seqDB search
MPLLHRKPFVRQKPPGDLRPDEEVFYCKVTNEIFRHYDDFFERTILCNSLVWSCAVTGRP
GLTYQEALESERKARQNLQSFPEPLIIPVLYLTNLTRRSRLHEICDDIFAYVKDRYFVEE
TVEVIRNNGTRLQCRILEVLPPLHQNGFANGHLSSADGETIVISDSDDSETQSSSFHHGK
KKDAIDPLLFRYRVQPTKKEMYESAVVKATQISRRKHLFSRDKLKLFLKQHCEAQDGVIK
IKASSFSAYNIAEQDFSYFFPDDPPTFIFSPANRRRGRPPKRISFGQEDSIASKQTAARY
RNKAIKERDKLLKQEEMRALAFEKAKLKRERADALEARKREKEDKEKKREELKKMVEEER
LKKKEEKERLKIEREKEREKLREEKRKYMEYLKQWSKPREDMECDDLKELPEPTPVKTRL
PPEVFGDALMVLEFLNAFGELFDLQDEFPEGVTLEVLEEALVGNDSEGPLCELLFFFLTA
IFQAMAEEEEEVAKEQITDADTKDLTEALDEDADPTKSALSAVAALAAAWPQLHQGCSLK
SLDLDSCTLSEILRLHILASGADVTSANAKYRYQKRGGFDATDDACMELRLSNPSLVKKL
SSTSVYDLTPGEKMKILHALCGKLLTLVSTRDFIEDYVDVLRQAKQEFRELKAEQHRKER
EATAARIRRRKEEKLKEQEQKMKEKQEKLKEDEQRNSAAVPGEEEREDFDTSTENKNIEQ
KDLDPDVVTEDEDDPGSHKRSRRGKVGQTAVKQCIKQEEMNYCIKQEPLSADAEEALRQE
QQQKEKELLDKIQSAIACTNIFPLGRDRLYRRYWIFPSIPGLFIEEDYSGLTEDMLLPRP
SSFHNNAQPRDPQVSIKTEESFLSESTSSLDQGPFDDSVLLPKPVHKPNRWCFYSSCAQL
DQLIDALNSRGHRESALKETLLQEKSRICAQLAHFSEEKFHFSDKPQADSKPVSSRGRSS
GACDISQMSAERQLELRLRDFLLDIEDRIYQGTLGAIKVTDRQVWRSALENGRYELLSEE
SKENGVIKTVNEDVEEMEMEQARVIVRDRLLGIKTETPSTISTSASTPQSVSNVVHYLAL
ALFQIEQGIERRFLKAPLDGNDSGRSYKTVLDRWRESLLSSASLSQVFLHLSTLDRSVMW
SKSILNARCKICRKKGDAENMVLCDGCDRGHHTYCVRPKLKAVPDGDWFCPECRPKQRSR
RLSSRQRPSLESDEEMEEGMEDDDDEVDDDDEEGQSEEEEYEVEQDEEDSDDDEALSPPK
RGRPQVRLPIKTKGRFGPSFPSRSQRQDPGRYPSRSQQSTPKNTAKSASKNLRKTRSAPP
TETRSLRVGSRSTRHSPSALQDVFVELLSPHSKRRGRKGADHTPEHSPSFTNFRVSTSRS
SRQLIPLNTAESLSLQHSESKRRGRKRQSTESSPVPLNRRSSGRQGGVHELSAFEQLVVE
LVRHDDSWPFLKLVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIDDIELMFSN
CFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLHVSPSTVDQVSTPLAAKKSRI
NT seq 4659 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgcttcaccgaaagcctttcgtgaggcagaagccgccgggggacctgcggccg
gacgaggaagttttctactgtaaagtcaccaacgagatcttccgccactacgatgacttt
tttgaacgaaccattctgtgcaacagccttgtgtggagctgtgccgtgacgggtagacct
ggactgacgtatcaggaagctcttgaatccgaaagaaaagcaagacagaacctccagagt
tttccagaaccactaattattcccgttttatacctgaccaaccttactcgtcgttcacgc
ttgcatgaaatctgtgatgatatctttgcctatgtcaaggaccgatattttgttgaagag
actgtggaagtcattcggaacaatggcacaaggctgcagtgtagaatcttggaagtcctc
cctccattacatcagaatggttttgctaacggacacctgagcagtgctgatggagagacg
attgtcatcagcgacagtgacgactcggaaacacaaagcagctcttttcaccatgggaag
aagaaagatgcaatcgatcccttattattcagatacagggttcagcccactaaaaaggag
atgtatgagtctgctgttgttaaagcaacacaaatcagccggagaaaacatctattttct
cgtgataaactaaagctttttctcaagcaacactgtgaagcacaagatggagtcattaaa
attaaggcatcatcattttcagcatataacatagcagagcaggacttctcttatttcttc
cctgatgacccacctactttcatcttcagtcctgctaacaggcgacgaggaagacctccc
aaacgaatatcttttggtcaggaagacagcattgctagtaagcagactgctgcaagatat
cggaacaaagctattaaagaaagagacaaacttctgaaacaggaagaaatgagggcactg
gctttcgaaaaggctaaactaaaacgagaaagagcggatgctttggaagcaagaaaaaga
gaaaaggaggataaagagaaaaaaagggaggaactgaagaaaatggtagaggaagagcga
ctaaagaaaaaagaagaaaaagagagacttaaaatagaaagagaaaaggaaagagaaaaa
ttacgtgaagaaaagcgaaaatatatggaatacttaaagcagtggagtaaacccagagaa
gatatggaatgtgatgaccttaaggaacttccagagcccacgccagtgaaaactagactc
cctcctgaagtcttcggcgatgcgctgatggttctggagttccttaatgcatttggggaa
ctttttgaccttcaagatgagtttcctgagggagtaaccttagaagtgttagaggaagct
cttgtaggaaatgacagtgaaggcccactgtgtgaattgctttttttcttcctgactgca
atcttccaggcgatggctgaagaagaggaggaagtagccaaagagcagataactgatgct
gacaccaaagatctaacagaggctttggatgaggacgcagaccccacaaaatctgcactg
tctgcagttgcagccttggccgctgcatggccacagttacaccagggctgcagtttgaaa
agcttggatcttgatagctgcactctttctgaaatcctcagactgcacatcttagcctca
ggtgctgatgtgacatcagcaaatgcaaagtacaggtatcagaaacgaggaggattcgac
gctacggacgatgcctgcatggagcttcggctgagcaatcccagtctggtgaaaaaattg
tccagcacttctgtatatgatttgacaccaggagaaaaaatgaagatactccatgctctc
tgtgggaagctactgaccctagtttctactagggatttcattgaagattatgttgatgtg
ttgcgacaggccaagcaggagttccgagagctcaaagcagaacagcaccgtaaagagaga
gaagccacagctgctcgaatacgtagaaggaaggaagaaaaacttaaggaacaagaacag
aaaatgaaagagaaacaagaaaaactgaaggaggacgagcagagaaattcagctgcagtt
ccaggggaagaagaaagggaagattttgatactagtactgagaacaaaaacatagagcag
aaagatctggaccctgatgtggttactgaagatgaagatgaccccggatcgcataaaagg
agcagaagagggaaagtgggacaaactgcagttaagcaatgtataaagcaagaagagatg
aactactgtataaagcaggagcctctgagtgccgacgcagaggaagctttgaggcaggag
cagcagcagaaagagaaagaactcctagacaagattcagagtgccatcgcctgtactaac
atcttccctctggggcgcgaccgcctgtacaggcgctactggatctttccttccattcct
ggtctgttcatagaagaggattattcaggtcttactgaagacatgttgctgcctaggcct
tcatcatttcacaataacgcacagcctcgcgatcctcaggtatctattaaaactgaagag
tccttcctgtctgaatctacctccagcctcgaccaaggtccgttcgatgactctgtgctg
ctgccaaaaccggtgcataagccaaatcggtggtgcttttacagttcttgtgcacagctg
gaccagctcattgacgctctcaactccagaggacaccgagaaagcgccttgaaagagacc
ttgctacaggagaagagcagaatatgcgcacagcttgcccacttctctgaagagaaattc
catttttcagacaaacctcaggctgatagcaagcctgtgtcttctcggggacgatcttct
ggtgcatgtgacatatcccagatgtctgcagagaggcagctggagctgaggctcagagac
tttctcttggatattgaggacagaatctatcaagggacactaggagccatcaaggttaca
gaccgacaggtctggagatcagccctggagaatgggcgatacgagctgttaagtgaggag
agcaaggaaaatggagtgattaaaactgtgaatgaggatgtggaagagatggaaatggaa
caagcaagggtcatagtaagagacagacttttggggattaaaaccgaaactccaagtacc
atctcaaccagtgccagtacaccacagtcagtgagcaatgtggttcattatctggccctg
gccctctttcagatagaacagggcattgaacggcgtttcctcaaagctccccttgatggc
aatgacagcggacgttcttataaaaccgtcctggaccgttggagggagtctctcctttcc
tctgctagtctttcccaagtgtttctgcatttatcaaccttggatcgcagtgtgatgtgg
tctaagtccatactgaacgcacgttgcaagatctgccggaaaaagggggatgctgaaaac
atggtgctgtgtgacggctgcgaccgagggcatcacacctactgcgtccgaccaaagctc
aaggctgttcctgatggagactggttttgtccagaatgtcgaccaaagcaacgttctaga
agactttcctctaggcagagaccatccttggaaagtgatgaagaaatggaagagggtatg
gaagatgatgatgatgaagttgacgatgatgatgaagagggtcaaagtgaggaggaagaa
tatgaggtggagcaagatgaggaggactctgacgacgacgaagcgctcagcccaccaaaa
cgaggaagaccccaagttagattgccaattaaaacaaaagggagatttggcccttctttc
ccaagtcgcagccaacgacaagaccctggaagatacccttcaaggagccagcagagcacg
cccaaaaacactgctaaatctgctagcaaaaacctgaggaaaacaagatctgctcctccc
acagaaactcgatccctaagagttggtagtcgctccactcgccacagtccgagtgcactg
caagatgtgtttgtggaactgcttagtcctcacagcaaacgcagaggacggaagggtgct
gatcataccccagagcacagtcccagcttcaccaacttcagggtcagcacctcgagatca
agcaggcagttgattcctttaaatactgctgaaagtctctctctccagcatagtgaatct
aagagaagaggcaggaaaagacaatctacagagtcatctcctgtaccactgaatcgaaga
agttctggcaggcaaggaggtgtccatgaactgtctgcttttgaacaacttgtcgtggaa
ctggtacggcatgatgatagctggccctttttgaaactggtttctaaaatccaggtccca
gactactatgacatcattaagaagcccattgccttaaatataattcgagaaaaagtaaat
aaatgtgaatataaattagcatctgagtttattgatgatattgagttaatgttttcaaac
tgctttgaatacaaccctcggaacacaagtgaagcaaaagctggaactcggcttcaagca
ttttttcatattcaagctcaaaagcttggactccacgtctcacccagtactgtggaccag
gttagcacgccactagctgcaaagaagtcacggatctaa

DBGET integrated database retrieval system