KEGG   Mus musculus (mouse): 217588Help
Entry
217588            CDS       T01002                                 

Gene name
Mbip, 4933408E06Rik
Definition
(RefSeq) MAP3K12 binding inhibitory protein 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
UniProt: 
Position
12; 12 C1
AA seq 341 aa AA seqDB search
MAAAAELSSSSGSERSLEQCSSPLLTREVLCEVFRSLHTLTRQLNLRDDVVKITIDWNRL
QSLSASQPALLLTALEQHVLYLQPFLAKLQSLMKENSTATEIRQTEAETKSELRAIHPTE
DLQDEGKPKDCDVGDVKKTQNLFDPEVVQIKAGKAEIDRRISAFIERKQAEINENNVREF
CNVIDCNQENSCARTDAVFTPYPGFKSHVKVSRVVNTYGPQTRPEGIAGSGHKPTGMLRD
CGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLEDKILELEGISPEYFQSVNFSGKR
RKVQPPQQNYSLAELDEKISALKRALLRKSREADSMAAHLP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgctgcggagcttagttcctcaagcggcagcgagaggagcctggagcaatgc
tccagccccctcctcacccgcgaggtcctctgcgaagtctttcgctccttgcacaccctg
acaagacagcttaacctcagagatgatgtggtgaaaattacaatcgattggaacaggctc
cagagcctctcagcatcccagcctgcactgctccttactgcacttgaacaacacgttttg
tatttacagccttttttagcaaaacttcagtctttaatgaaagaaaactcaacagctaca
gagataagacagacagaagcagagaccaagagtgaactaagagccatacatcccaccgag
gacctacaagatgaagggaagcccaaagactgtgatgtaggagatgtgaaaaagacacaa
aacctttttgacccagaagtagttcagatcaaggctggaaaagcagaaattgacagacga
atatctgcatttattgagagaaaacaagctgaaatcaatgaaaacaatgtcagggaattt
tgcaatgttattgattgtaatcaagaaaatagttgtgcaagaactgatgctgtctttact
ccttatcctggatttaaaagtcatgtaaaggtttctagagttgtgaatacatatggacca
cagactagacctgaaggaattgcagggtcaggtcacaaacctacaggcatgcttcgagat
tgtggtaatcaggcggtagaagaacgactccagaatattgaggctcacctgcgattgcag
acaggtggcccagtaccaagagacatctaccaaagaattaaaaagcttgaagataaaatc
cttgaattggagggcatctctcctgaatacttccaatctgtaaacttctctggaaaaaga
agaaaagtccaaccacctcaacagaactattcactggctgaactggatgagaaaattagt
gccctcaaacgagccctgctcagaaagtcaagagaagcagactccatggccgctcacctt
ccatga

DBGET integrated database retrieval system