KEGG   Mus musculus (mouse): 217734Help
Entry
217734            CDS       T01002                                 

Gene name
Pomt2, A830009D15Rik, AW046274
Definition
protein-O-mannosyltransferase 2 (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
mmu  Mus musculus (mouse)
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:mmu00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
12 D2; 12
AA seq 820 aa AA seqDB search
MLYASGRLLAARAATTLSAPPRARGPALRGKRRELQIPWHLETPSYDPLTGQRTRPGVPP
ARRVILRKGRMPPAIGGGLAGSELRPRRGRCVPQAARAVSRDVVPQAAARKLKRPAWSSR
RFQAAGWWATLAVVTLLSFATRFHRLDQPAHICWDETHFGKMGSYYINRTFFFDVHPPLG
KMLIGLAGYLSGYDGTFLFQKPGDRYEHHSYMGMRGFCAFLGSWLIPFAYLTVLDLSKSF
PAALLTAALLTFDTGCLTLSQYILLDPILMFFIMAAMLSMVKYNSCANRPFSAPWWFWLS
LTGISLAGALGVKFVGLFIIVQVGLNTISDLWHLFGDLSLSLVTVGKHLTARILCLIVLP
LVLYVTIFAVHVMVLNKSGPGDGFFSSAFQARLSGNSLHNASIPEHLAYGSVITVKNLRM
AIGYLHSHRHLYPEGIGARQQQVTTYLHKDYNNLWIIKKYNANTDPLDPSFPVEFVRHGD
IIRLEHKETTRNLHSHYHEAPLTRKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVL
RSRIRLIHLVTGCVLGSSGKILPKWGWEQLEVTCTPYLKETTNSIWNIEEHINPKLPNIS
LDVLQPSFPEILLESHMVMIRGNNGLKPKDNEFTSKPWHWPINYQGLRFSGANDTDFRVY
LLGNPVVWWLNLVSIVLYLLSGSTIAVAMQRGIQLPAELQGLTKVLLRGGGQLLLGWMLH
YFPFFLMGRILYFHHYFPAMLFSSMLTGILWDTLLRLCAWGLAPSPLGRRIHAVGILSLL
LTTAYSFYLFHPLAYGMVGPLAQEPESPMAGLRWLESWDF
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgctctacgcctcaggccgcctcttagctgcccgggcggccaccacactttccgccccg
cccagagcccggggcccggcgctccgcggcaaacggagggaactacaaatcccatggcac
ctcgagacgccttcttatgaccccttgacggggcagcggacaagacccggcgtgcctccg
gcccggagggtgatccttcggaaggggaggatgccgccggccataggcggtggcctagcg
ggctccgagctgcgtccccgtaggggccgctgtgtgccgcaggctgccagagccgtgagc
cgagacgtggtcccccaggctgcagcacggaaacttaaacggcctgcttggagctcgcgg
cgcttccaggcggcagggtggtgggccacgttggctgtggtgacgctgctgtcctttgcc
acccgctttcaccggctggaccagcctgctcacatctgttgggatgagactcactttgga
aaaatgggaagttactatattaaccgcacctttttctttgatgtgcatccaccactggga
aagatgctgatcggtcttgctggctacctgagcgggtatgatggtacctttctgttccag
aagcctggggacagatacgagcaccacagctacatgggaatgagaggattctgtgctttc
ctgggttcctggctgatcccctttgcctacctcaccgtactggatctgtccaagtccttc
ccagcagcactgctcaccgctgcccttctcacctttgacacaggatgcctcactctatcc
cagtacatcctccttgaccccatcctgatgttcttcatcatggcggccatgctgagcatg
gtcaagtacaactcctgtgctaacaggcctttctctgccccctggtggttctggctcagc
ctgactggcattagtctcgctggtgctttaggggtcaaatttgttggcctctttatcatc
gtgcaagtggggttgaacactatttcagacctctggcatctgtttggagacctcagcctt
tcactggtgactgtggggaagcacctaactgctcgcatcctgtgcctcatagtgctgcct
ttggtgctctatgtgaccatttttgctgttcatgtcatggtgctgaataaaagtggtcct
ggtgatggcttcttcagttctgcctttcaagcccggctttcagggaacagccttcacaat
gcttctatccctgaacacctggcgtatggctctgtaatcactgtgaagaatctccggatg
gccattggctacctgcactctcataggcacctctaccctgagggcattggtgctcgccag
cagcaggttaccacctatttgcataaggactacaacaacttgtggattatcaagaagtat
aatgccaacacagatcccctagacccttcattcccagtggagtttgtcagacatggagac
atcatacgactagaacacaaagaaactactcggaacctgcacagtcactatcatgaggct
cccctgacccggaagcactatcaggtcactggctatggcataaatgggacaggggactca
aatgacttctggcggattgaagttgtaaatagaaaatttgggaaccggatcaaggtactg
agaagtcgaattcgcctcatccatttggtcacaggttgtgtcctgggatcgtcaggaaag
attctgcctaagtggggctgggagcagttggaagttacctgtactccgtacctaaaagaa
accactaactccatttggaacatagaagagcatatcaatcccaaattgccaaacatcagc
ctggatgtgctgcagcccagttttcctgagatcttgctggagtctcacatggtcatgatc
cggggaaataatggcctcaaacccaaggacaatgagttcacatccaagccctggcactgg
cctatcaattatcagggcctgcgcttctcaggggccaatgacacggacttccgagtctat
ctgctcggcaaccctgtggtctggtggctgaatctggtgagcattgtcctctacctcctc
tcggggagcaccattgctgtggctatgcagagagggatacaactgcctgcagagttgcaa
gggctgaccaaggtgctgctgcgaggaggtggccagctgctcctgggatggatgctccat
tacttccctttcttcttgatgggccggatcctctacttccaccactacttcccagccatg
ctcttttccagcatgttgacaggtatcctatgggatactctcctgcggctctgtgcctgg
ggcttggccccttctcccctgggtaggaggatacatgcggtgggaatcctgagcctgctt
ctgacaactgcctacagcttctacctcttccaccctctggcttatgggatggttggtccc
ctagcccaggaacctgagagtccaatggcaggactgaggtggctggaatcatgggacttt
tga

DBGET integrated database retrieval system