KEGG   Mus musculus (mouse): 217866Help
Entry
217866            CDS       T01002                                 

Gene name
Cdc42bpb, MRCKb
Definition
(RefSeq) CDC42 binding protein kinase beta (EC:2.7.11.1)
  KO
K16307  
serine/threonine-protein kinase MRCK [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     217866 (Cdc42bpb)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: AGC group
  DMPK family [OT]
   217866 (Cdc42bpb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
12 F1; 12 60.94 cM
AA seq 1713 aa AA seqDB search
MSAKVRLKKLEQLLLDGPWRNDSALSVETLLDVLVCLYTECSHSALRRDKYVAEFLEWAK
PFTQLVKDMQLHREDFEIIKVIGRGAFGEVAVVKMKNTERIYAMKILNKWEMLKRAETAC
FREERDVLVNGDCQWITALHYAFQDENYLYLVMDYYVGGDLLTLLSKFEDKLPEDMARFY
IGEMVLAIDSIHQLHYVHRDIKPDNVLLDVNGHIRLADFGSCLKMNDDGTVQSSVAVGTP
DYISPEILQAMEDGMGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHEERF
QFPSHVTDVSEEAKDLIQRLICSRERRLGQNGIEDFKKHAFFEGLNWENIRNLEAPYIPD
VSSPSDTSNFDVDDDMLRNIEILPPGSHTGFSGLHLPFIGFTFTTESCFSDRGSLKSMTQ
SNTLTKDEDVQRDLENSLQIEAYERRIRRLEQEKLELSRKLQESTQTVQSLHGSTRALGN
SNRDKEIKRLNEELERMKSKMADSNRLERQLEDTVTLRQEHEDSTHRLKGLEKQYRLARQ
EKEELHKQLVEASERLKSQTKELKDAHQQRKRALQEFSELNERMSELRSLKQKVSRQLRD
KEEEMEVAMQKIDSMRQDLRKSEKSRKELEARLEDAAAEASKERKLREHSESFCKQMERE
LEALKVKQGGRGPGAASEHQQEISKIRSELEKKVLFYEEELVRREASHVLEVKNVKKEVH
DSESHQLALQKEVLMLKDKLEKSKRERHSEMEEAIGTVKDKYERERAMLFDENKKLTAEN
EKLCSFVDKLTAQNRQLEDELQDLASKKESVAHWEAQIAEIIQWVSDEKDARGYLQALAS
KMTEELETLRSSSLGSRTLDPLWKVRRSQKLDMSARLELQSALEAEIRAKQLVQEELRKV
KDSSLAFESKLKESEAKNRELLEEMQSLRKRMEEKFRADTGLKLPDFQDSIFEYFNTAPL
AHDLTFRTSSASDQETQASKMDLSPSVSVATSTEQQEDMARPQQRPSPVPLPSTQALAMA
GPKPKAHQFSIKSFPSPTQCSHCTSLMVGLIRQGYACEVCAFSCHVSCKDSAPQVCPIPP
EQSKRPLGVDVQRGIGTAYKGYVKVPKPTGVKKGWQRAYAVVCDCKLFLYDLPEGKSTQP
GVVASQVLDLRDEEFAVSSVLASDVIHATRRDIPCIFRVTASLLGSPSKTSSLLILTENE
NEKRKWVGILEGLQAILHKNRLKSQVVHVAQEAYDSSLPLIKAVLAAAIVDGDRIAVGLE
EGLYVIELTRDVIVRAADCKKVYQIELAPKEKIAILLCGRNHHVHLYPWSSFDGAEASNF
DIKLPETKGCQLIATGTLRKSSSTCLFVAVKRLILCYEIQRTKPFHRKFSELVAPGHVQW
MAVFKDRLCVGYPSGFSLLSIQGDGPPLDLVNPTDPSLAFLSQQSFDALCAVELKSEEYL
LCFSHMGLYVDPQGRRSRMQELMWPAAPVACSCSPTHVTVYSEYGVDVFDVRTMEWVQTI
GLRRIRPLNSDGSLNLLGCEPPRLIYFKNKFSGTILNVPDTSDNSKKQMLRTRSKRRFVF
KVPEEERLQQRREMLRDPELRSKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAAPTVQEE
KQGPTPAGLPRQPPSRSKPYVSWPSSGGSEPGVPVPLRSMSDPDQDFDKEPDSDSTKHST
PSNSSNPSGPPSPNSPHRSQLPMEGLDQPSCDA
NT seq 5142 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccaaggtgcggctcaagaagctggagcagctgctcctggacgggccgtggcgc
aacgatagcgccctgagcgtggagacgctgctggacgtgctggtgtgcctttacaccgag
tgcagccactcggcgctgcgccgcgacaagtatgtggcggagttcctcgagtgggccaag
cctttcacccagctcgtgaaggacatgcagcttcatcgagaagacttcgagatcatcaaa
gtgatcgggagaggagcctttggtgaggttgctgttgtcaaaatgaagaacactgaacga
atttatgcaatgaaaattctcaacaaatgggaaatgctaaagagagcagagacagcttgc
tttcgagaagagcgtgacgtgctggtgaacggcgactgccagtggatcacggctctgcac
tatgcctttcaggatgagaactacctgtacttggtcatggattactatgtaggtggtgat
ctgctgaccctgctgagtaagtttgaagacaagcttccggaagacatggcgaggttctac
attggcgagatggtgttggccattgactcgatccaccagctccactatgtgcacagagac
atcaagcccgacaacgtccttctagatgtgaacggtcacatccgcctggctgactttggc
tcgtgcttgaagatgaacgatgatggcactgttcagtcttccgtggccgtgggcacacct
gactacatctcaccagagatcctgcaggccatggaggatggcatgggcaaatacgggccc
gagtgtgactggtggtcgctgggcgtctgcatgtatgagatgctatacggagaaaccccg
ttctacgcagagtctctggtggagacatacgggaagatcatgaaccacgaggagcggttt
cagttcccatcccatgtcaccgatgtctctgaagaagcaaaagaccttatccagagacta
atatgcagcagagagcgccgacttgggcagaatggaatagaagactttaagaaacacgca
ttctttgaaggtctgaattgggagaatatacgaaaccttgaagcgccctacattcccgat
gtgagcagcccttcggacacgtccaacttcgatgtggacgacgacatgctgagaaacatt
gaaatcttacctcccggctctcacacgggcttctcgggactgcatttgcccttcatcggt
ttcacattcacgacggaaagctgcttttctgaccggggctctctgaagagcatgactcag
tctaacacgctaaccaaagacgaagatgtgcagcgggacttggagaacagcttgcagatc
gaagcgtacgagcgaaggatacggaggctggagcaggagaagctggagctcagccggaag
ctgcaagaatccacccagactgtgcagtcccttcacggttccacacgggccctgggcaac
tcaaaccgcgacaaggaaatcaagaggctgaatgaagagcttgaacgcatgaagagtaaa
atggcagattcaaacaggctcgaacgccagctggaggacacagtgacacttcgccaggag
catgaggactccacacaccggctgaagggcctcgagaagcagtaccgcctggcccggcag
gagaaggaagaattgcacaagcaattggttgaggcttcagagcgattgaaatcccagacc
aaagaacttaaagacgcgcatcagcagcgaaaacgggccctgcaggagttctcagagctc
aatgagcgcatgtcggagctcaggtcgctgaagcagaaggtgtcccgtcagctccgggac
aaggaggaggagatggaggtggccatgcagaagatcgactccatgcggcaggacctccgc
aagtctgagaagtccaggaaagagctggaagctcggcttgaggacgcagctgccgaggcc
tctaaggagcggaagctccgagaacacagcgagagcttctgtaagcagatggagcgcgag
ctcgaggccctcaaggtaaagcaaggaggccgggggccaggggccgcgtcggaacatcag
caggagatctccaaaatcaggtcggagctcgagaagaaagtcttgttctacgaggaggag
ctggtgcgccgagaggcctcccacgtgctagaagtaaagaacgtgaagaaggaagtccac
gactccgaaagccaccagttggccctgcagaaagaggtcctgatgctgaaagacaagtta
gaaaagtcaaagcgagaacggcacagtgagatggaggaggccataggcaccgtgaaggac
aagtacgaacgggagagggccatgctgttcgatgagaacaagaagttaacagcagaaaac
gaaaagctttgttcctttgtggataaactaacagcccaaaacagacagctggaagatgag
ctgcaggatctggcatccaagaaggagtcagttgcgcactgggaggcgcagatcgcagag
atcattcagtgggtcagcgatgagaaagatgccagaggctaccttcaagcccttgcttct
aagatgaccgaagagcttgagaccttgcgaagttctagtttgggatccaggacactggat
ccactctggaaagttcgtcggagtcagaagctggacatgtctgcacggctggaattgcag
tctgctcttgaggccgagatccgtgccaaacagctcgttcaggaggagctgaggaaggtc
aaagacagcagcctggccttcgaaagcaaactgaaggaatcggaagcgaaaaacagggaa
ttgttagaagaaatgcaaagtctgaggaagaggatggaagagaagtttagagcggataca
gggctcaaacttccagatttccaggattctatctttgagtatttcaacactgctcctctt
gcacatgatctgacttttagaaccagctcagctagtgaccaggaaacacaggcttcaaag
atggacttgtccccatcagtgtctgtagccacgagcacagagcagcaggaggatatggct
cggccacagcagaggccgtctcctgtgccactgcccagcacgcaggccctcgccatggct
ggaccgaagcccaaagcccaccagttcagcatcaagtccttccctagccccacccagtgc
agccactgcacgtccttgatggtcggactgatccgacagggctacgcctgtgaggtctgt
gcattttcctgccatgtgtcctgcaaagacagcgctccccaggtgtgccccatacctcct
gagcagtccaagaggcctcttggcgtagacgtgcagaggggcataggcacggcctacaag
ggctacgtcaaggtcccaaagcccacaggcgtgaagaaaggatggcagagggcttacgcc
gtggtctgtgactgcaaactcttcctgtacgacctgccagaagggaagtcgacccagccc
ggtgtcgttgccagtcaagtcttggacctcagagatgaggagtttgctgtgagttcagtc
ctggcctcagatgttatccatgctacacgccgagacattccgtgcatattcagggtgacg
gcctctctcttaggttcgccttctaagaccagctcactgctcatcctgacggagaacgag
aatgaaaagaggaagtgggtagggatccttgaagggctgcaggccatcttgcataagaac
cggctgaagagccaggtagtgcacgtcgcacaggaggcctacgacagctcgctgccgctc
atcaaggccgtcctggctgctgctatcgtggatggagacaggattgcggtcggcctggaa
gaagggctctacgtcattgagctcacccgagacgtgatcgtccgcgctgctgactgcaag
aaggtgtaccagatcgagctggcgcccaaggagaagatcgccatcctcctgtgtggccgg
aaccaccatgtgcacctctacccctggtcctccttcgacggagcagaagcgagcaacttt
gacatcaagctcccggaaacaaagggctgccagctcatagcgacagggacgctgaggaag
agctcgtccacctgcctgtttgtcgctgtgaagcgactaatcctttgctacgagatccag
agaactaagcctttccacaggaagttcagtgagctggtggctccgggacacgtgcagtgg
atggccgtgttcaaggacaggctctgtgttggctacccctctgggttctctctgttgagc
atccagggggacgggccgcctctcgacctggtaaatcccactgacccctcgctcgcgttc
ctctcacagcagtctttcgatgccctctgtgctgtggagctcaaaagtgaggagtacctg
ctttgcttcagccacatgggactgtacgtggaccctcaaggtcggaggtcacgcatgcag
gagctcatgtggcctgcggctcctgtcgcctgtagttgcagccccacccatgtcacagtg
tacagcgaatacggggtggatgtcttcgacgtgcgcaccatggagtgggttcagaccatc
ggcctgcggaggataagacctctgaactctgatggcagcctcaacctgctgggctgtgag
ccccctcgcctcatctacttcaaaaacaagttctcaggaacaatcctcaatgtgcccgac
acctcggacaacagcaagaagcagatgctgaggacacggagcaaacgacgttttgtcttc
aaggttcccgaggaagagcggctacagcagcggcgagagatgctcagagaccccgaactg
cgatccaaaatgatatccaacccaaccaacttcaaccacgtggctcacatgggtcctggg
gatggcatgcaggtgctcatggacctgcctctgagtgctgcacccactgtccaggaggag
aagcagggccctaccccagcaggcctcccccggcagccgccatccaggagcaagccctat
gtctcgtggccgtcgtcaggtgggtccgagcctggagtgcctgtgcctctgaggagcatg
tccgaccccgaccaggattttgacaaagagcctgactctgattccaccaaacactcaact
ccatccaatagctccaaccctagcggccccccaagccccaactcgccccatcggagccag
ctccctatggaaggcctggaccagccatcctgtgacgcctga

DBGET integrated database retrieval system