KEGG   Mus musculus (mouse): 21813Help
Entry
21813             CDS       T01002                                 

Gene name
Tgfbr2, 1110020H15Rik, AU042018, DNIIR, RIIDN, TBR-II, TbetaR-II, TbetaRII
Definition
(RefSeq) transforming growth factor, beta receptor II
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04068  FoxO signaling pathway
mmu04144  Endocytosis
mmu04218  Cellular senescence
mmu04350  TGF-beta signaling pathway
mmu04380  Osteoclast differentiation
mmu04390  Hippo signaling pathway
mmu04520  Adherens junction
mmu04659  Th17 cell differentiation
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05142  Chagas disease (American trypanosomiasis)
mmu05166  HTLV-I infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05220  Chronic myeloid leukemia
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Module
mmu_M00680  TGF-beta signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    21813 (Tgfbr2)
   04350 TGF-beta signaling pathway
    21813 (Tgfbr2)
   04390 Hippo signaling pathway
    21813 (Tgfbr2)
   04068 FoxO signaling pathway
    21813 (Tgfbr2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    21813 (Tgfbr2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    21813 (Tgfbr2)
  Cell growth and death
   04218 Cellular senescence
    21813 (Tgfbr2)
  Cellular community - eukaryotes
   04520 Adherens junction
    21813 (Tgfbr2)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    21813 (Tgfbr2)
  Endocrine system
   04926 Relaxin signaling pathway
    21813 (Tgfbr2)
  Development
   04380 Osteoclast differentiation
    21813 (Tgfbr2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    21813 (Tgfbr2)
   05202 Transcriptional misregulation in cancers
    21813 (Tgfbr2)
   05210 Colorectal cancer
    21813 (Tgfbr2)
   05212 Pancreatic cancer
    21813 (Tgfbr2)
   05225 Hepatocellular carcinoma
    21813 (Tgfbr2)
   05226 Gastric cancer
    21813 (Tgfbr2)
   05220 Chronic myeloid leukemia
    21813 (Tgfbr2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    21813 (Tgfbr2)
  Infectious diseases
   05166 HTLV-I infection
    21813 (Tgfbr2)
   05142 Chagas disease (American trypanosomiasis)
    21813 (Tgfbr2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     21813 (Tgfbr2)
Protein kinases [BR:mmu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   21813 (Tgfbr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ecTbetaR2 Pkinase_Tyr Pkinase Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 21813
NCBI-ProteinID: NP_033397
MGI: 98729
Ensembl: ENSMUSG00000032440
Vega: OTTMUSG00000062871
UniProt: Q62312 Q543C0 Q8BQS9
Position
9 F3; 9 68.39 cM
AA seq 592 aa AA seqDB search
MGRGLLRGLWPLHIVLWTRIASTIPPHVPKSDVEMEAQKDASIHLSCNRTIHPLKHFNSD
VMASDNGGAVKLPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDKNI
TLETVCHDPKLTYHGFTLEDAASPKCVMKEKKRAGETFFMCACNMEECNDYIIFSEEYTT
SSPDLLLVIIQVTGVSLLPPLGIAIAVIIIFYCYRVHRQQKLSPSWESSKPRKLMDFSDN
CAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVA
VKIFPYEEYSSWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQE
YLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCL
CDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLW
EMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDSVLRDRGRPEIPSFWLNHQGIQIVCE
TLTECWDHDPEARLTAQCVAERFSELEHPERLSGRSCSQEKIPEDGSLNTTK
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgggggctgctccggggcctgtggccgctgcatatcgtcctgtggacgcgcatc
gccagcacgatcccgccgcacgttcccaagtcggatgtggaaatggaagcccagaaagat
gcatccatccacctaagctgtaataggaccatccatccactgaaacattttaacagtgat
gtcatggccagcgacaatggcggtgcggtcaagcttccacagctgtgcaagttttgcgat
gtgagactgtccacttgcgacaaccagaagtcctgcatgagcaactgcagcatcacggcc
atctgtgagaagccgcatgaagtctgcgtggccgtgtggaggaagaacgacaagaacatt
actctggagacggtttgccacgaccccaagctcacctaccacggcttcactctggaagat
gccgcttctcccaagtgtgtcatgaaggaaaagaaaagggcgggcgagactttcttcatg
tgtgcctgtaacatggaagagtgcaacgattacatcatcttttcggaagaatacaccacc
agcagtcccgacctgttgttggtcattatccaagtgacgggtgtcagcctcctgcctccg
ctggggattgccatagctgtcatcatcatcttctactgctaccgtgtccaccggcagcag
aagctgagcccgtcctgggagagcagcaagccccggaaactgatggatttcagtgacaat
tgtgccatcatcctggaggacgaccgctccgacatcagctccacgtgcgccaacaacatc
aaccacaacacggagctgctgcccatcgagctggacacgctggtggggaagggccgcttc
gccgaggtctacaaggccaagctgaagcagaacacctcagagcagtttgagaccgtggct
gtcaagatcttcccctacgaggagtactcctcgtggaaaacagagaaggacatcttctcc
gatatcaacctgaagcatgagaacatcctgcagttcctgacggccgaggagcggaagaca
gagctgggcaagcagtactggctgatcacggcgttccacgcgaagggcaacctgcaggag
tacctcacgaggcatgtcatcagctgggaggacctgaggaagctgggcagctccctggcc
cggggcatcgctcatctccacagtgaccacactccttgtgggaggcccaagatgcccatt
gttcacagggacctcaagagctctaacatcctagtgaagaacgacttgacctgttgcctg
tgtgacttcgggctgtccttgcgcctggaccctactctgtctgtggatgacctggccaac
agcgggcaggtgggaacggcaagatacatggccccggaagttctagaatccaggatgaat
ctggaaaacgtggagtcgttcaagcagacggatgtctactccatggctctggtactctgg
gaaatgacgtcccgctgcaatgctgtgggagaagtgaaggattacgagcccccatttggt
tccaaggtgcgggagcacccctgtgtggagagcatgaaagacagtgtgctgagagaccga
gggcggccggaaattcccagcttctggctcaaccaccagggcatccagatcgtgtgtgag
actttgaccgagtgctgggaccatgaccccgaagcccgtctcacagcacagtgtgtggca
gagcgcttcagtgagctggagcatccggagagactctctgggaggagctgctcccaggag
aagattccagaagatggctcgctgaacactaccaaatag

DBGET integrated database retrieval system