KEGG   Mus musculus (mouse): 21813Help
Entry
21813             CDS       T01002                                 

Gene name
Tgfbr2, 1110020H15Rik, AU042018, DNIIR, RIIDN, TBR-II, TbetaR-II, TbetaRII
Definition
transforming growth factor, beta receptor II (EC:2.7.11.30)
Orthology
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Osteoclast differentiation
Hippo signaling pathway
Adherens junction
Chagas disease (American trypanosomiasis)
HTLV-I infection
Pathways in cancer
Transcriptional misregulation in cancer
Colorectal cancer
Pancreatic cancer
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    21813 (Tgfbr2)
   04350 TGF-beta signaling pathway
    21813 (Tgfbr2)
   04390 Hippo signaling pathway
    21813 (Tgfbr2)
   04068 FoxO signaling pathway
    21813 (Tgfbr2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    21813 (Tgfbr2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    21813 (Tgfbr2)
  Cell communication
   04520 Adherens junction
    21813 (Tgfbr2)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    21813 (Tgfbr2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    21813 (Tgfbr2)
   05202 Transcriptional misregulation in cancers
    21813 (Tgfbr2)
   05210 Colorectal cancer
    21813 (Tgfbr2)
   05212 Pancreatic cancer
    21813 (Tgfbr2)
   05220 Chronic myeloid leukemia
    21813 (Tgfbr2)
  Infectious diseases
   05166 HTLV-I infection
    21813 (Tgfbr2)
   05142 Chagas disease (American trypanosomiasis)
    21813 (Tgfbr2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     21813 (Tgfbr2)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [OT]
   21813 (Tgfbr2)
Enzyme-linked receptors [BR:mmu01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   21813 (Tgfbr2)
Cytokine receptors [BR:mmu04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   21813 (Tgfbr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
9 F3; 9 68.39 cM
AA seq 592 aa AA seqDB search
MGRGLLRGLWPLHIVLWTRIASTIPPHVPKSDVEMEAQKDASIHLSCNRTIHPLKHFNSD
VMASDNGGAVKLPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDKNI
TLETVCHDPKLTYHGFTLEDAASPKCVMKEKKRAGETFFMCACNMEECNDYIIFSEEYTT
SSPDLLLVIIQVTGVSLLPPLGIAIAVIIIFYCYRVHRQQKLSPSWESSKPRKLMDFSDN
CAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVA
VKIFPYEEYSSWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQE
YLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCL
CDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLW
EMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDSVLRDRGRPEIPSFWLNHQGIQIVCE
TLTECWDHDPEARLTAQCVAERFSELEHPERLSGRSCSQEKIPEDGSLNTTK
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgggggctgctccggggcctgtggccgctgcatatcgtcctgtggacgcgcatc
gccagcacgatcccgccgcacgttcccaagtcggatgtggaaatggaagcccagaaagat
gcatccatccacctaagctgtaataggaccatccatccactgaaacattttaacagtgat
gtcatggccagcgacaatggcggtgcggtcaagcttccacagctgtgcaagttttgcgat
gtgagactgtccacttgcgacaaccagaagtcctgcatgagcaactgcagcatcacggcc
atctgtgagaagccgcatgaagtctgcgtggccgtgtggaggaagaacgacaagaacatt
actctggagacggtttgccacgaccccaagctcacctaccacggcttcactctggaagat
gccgcttctcccaagtgtgtcatgaaggaaaagaaaagggcgggcgagactttcttcatg
tgtgcctgtaacatggaagagtgcaacgattacatcatcttttcggaagaatacaccacc
agcagtcccgacctgttgttggtcattatccaagtgacgggtgtcagcctcctgcctccg
ctggggattgccatagctgtcatcatcatcttctactgctaccgtgtccaccggcagcag
aagctgagcccgtcctgggagagcagcaagccccggaaactgatggatttcagtgacaat
tgtgccatcatcctggaggacgaccgctccgacatcagctccacgtgcgccaacaacatc
aaccacaacacggagctgctgcccatcgagctggacacgctggtggggaagggccgcttc
gccgaggtctacaaggccaagctgaagcagaacacctcagagcagtttgagaccgtggct
gtcaagatcttcccctacgaggagtactcctcgtggaaaacagagaaggacatcttctcc
gatatcaacctgaagcatgagaacatcctgcagttcctgacggccgaggagcggaagaca
gagctgggcaagcagtactggctgatcacggcgttccacgcgaagggcaacctgcaggag
tacctcacgaggcatgtcatcagctgggaggacctgaggaagctgggcagctccctggcc
cggggcatcgctcatctccacagtgaccacactccttgtgggaggcccaagatgcccatt
gttcacagggacctcaagagctctaacatcctagtgaagaacgacttgacctgttgcctg
tgtgacttcgggctgtccttgcgcctggaccctactctgtctgtggatgacctggccaac
agcgggcaggtgggaacggcaagatacatggccccggaagttctagaatccaggatgaat
ctggaaaacgtggagtcgttcaagcagacggatgtctactccatggctctggtactctgg
gaaatgacgtcccgctgcaatgctgtgggagaagtgaaggattacgagcccccatttggt
tccaaggtgcgggagcacccctgtgtggagagcatgaaagacagtgtgctgagagaccga
gggcggccggaaattcccagcttctggctcaaccaccagggcatccagatcgtgtgtgag
actttgaccgagtgctgggaccatgaccccgaagcccgtctcacagcacagtgtgtggca
gagcgcttcagtgagctggagcatccggagagactctctgggaggagctgctcccaggag
aagattccagaagatggctcgctgaacactaccaaatag

DBGET integrated database retrieval system