KEGG   Mus musculus (mouse): 21826Help
Entry
21826             CDS       T01002                                 

Gene name
Thbs2, TSP2, Thbs-2
Definition
thrombospondin 2
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
mmu  Mus musculus (mouse)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mmu04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:mmu04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:mmu04145]
Cellular Processes; Cell communication; Focal adhesion [PATH:mmu04510]
Human Diseases; Infectious diseases; Malaria [PATH:mmu05144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
17 A3-B; 17 8.95 cM
AA seq 1172 aa AA seqDB search
MLWALALLALGIGPRASAGDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRF
DYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGP
GDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFY
EQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGAEVNTISEH
TETLHLSPHITTDLVVQGVEKAQEVCTHSCEELSNMMNELSGLHVMVNQLSKNLERVSSD
NQFLLELIGGPLKTRNMSACVQEGRIFAENETWVVDSCTTCTCKKFKTVCHQITCSPATC
ANPSFVEGECCPSCSHSADSDEGWSPWAEWTECSVTCGSGTQQRGRSCDVTSNTCLGPSI
QTRTCSLGKCDTRIRQNGGWSHWSPWSSCSVTCGVGNVTRIRLCNSPVPQMGGKNCKGSG
RETKPCQRDPCPIDGRWSPWSPWSACTVTCAGGIRERSRVCNSPEPQYGGKDCVGDVTEH
QMCNKRSCPIDGCLSNPCFPGAKCNSFPDGSWSCGSCPVGFLGNGTHCEDLDECAVVTDI
CFSTNKAPRCVNTNPGFHCLPCPPRYKGNQPFGVGLEDARTEKQVCEPENPCKDKTHSCH
KNAECIYLGHFSDPMYKCECQIGYAGDGLICGEDSDLDGWPNNNLVCATNATYHCIKDNC
PKLPNSGQEDFDKDGIGDACDEDDDNDGVSDEKDNCQLLFNPRQLDYDKDEVGDRCDNCP
YVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL
MHNPDQIDQDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNSNQADHDNDGKGDACDSDD
DNDGVPDDRDNCRLVFNPDQEDSDGDGRGDICKDDFDNDNVPDIDDVCPENNAITETDFR
NFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDR
DDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDKPSRAYGYSGVSLKVVNSTTGTGEHLRN
ALWHTGNTEGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKTGYMRVLVHEGKQVMADSGPI
YDQTYAGGRLGLFVFSQEMVYFSDLKYECRDA
NT seq 3519 nt NT seq  +upstreamnt  +downstreamnt
atgctctgggcactggccctgctggctctgggcatagggccaagagcttctgctggtgac
cacgtcaaggacacttcatttgaccttttcagcatcagcaacattaaccggaagaccatc
ggtgccaagcagttccgagggcctgaccccggggtgcccgcctaccgttttgtacggttt
gactacatccccccagtgaacacagatgatctcaacaggattgtcaagcttgcaaggaga
aaggagggcttcttcctcacagcccaactgaagcaggaccgcaagtctcggggaacgctc
ctggtgttggaaggccccggcacctcccagaggcagtttgagattgtgtccaatggccca
ggggacactttggacctcaactactgggtagaaggcaatcagcataccaacttcctggag
gatgtgggcctggctgactcccagtggaagaatgtgactgtgcaggtggccagtgacacc
tatagcctgtatgtgggctgcgatcttatcgacagtgtcaccctggaagaaccattctat
gagcagctagaagtagacaggagcaggatgtacgtggccaaaggtgcatctcgagagagt
cacttcaggggcttgctgcagaatgtccatctcgtgtttgcagattctgtggaagatatc
ttaagcaagaaaggctgtcaacacagccagggagctgaagtcaacaccatcagtgaacat
acagagactctccatctgagccctcacatcaccacagatctcgtggtccagggtgtggag
aaggcacaggaggtgtgtacgcactcctgcgaggagttgagcaacatgatgaatgagctc
tctggactgcacgtcatggtgaaccagctgagcaagaacctggagagagtgtctagtgat
aaccagttccttttggagctcattgggggccctctgaagacaagaaacatgtcagcctgt
gtgcaggagggccgaatctttgcagaaaatgaaacctgggttgtggatagttgtaccaca
tgcacctgcaagaaatttaaaacagtctgccatcagatcacctgctcacctgcaacttgt
gccaacccatcttttgtggaaggcgagtgctgtccatcctgttcacactctgcagacagt
gatgagggctggtctccgtgggcagagtggaccgagtgttctgtcacctgtggctctggg
acccagcagagaggccggtcttgtgatgtcaccagcaacacctgcctgggcccctccatt
cagacaaggacatgcagcctgggcaaatgtgatacgagaatccgtcagaatggaggctgg
agtcactggtcaccctggtcttcatgctccgtgacttgtggagttggcaatgtcacccgc
atacgtctctgcaactcaccagtgccccagatgggtggcaagaactgcaagggcagcggc
cgggaaaccaaaccctgtcagcgtgatccgtgcccaattgatggccgctggagcccctgg
tccccttggtcagcctgcacagttacctgtgctggagggatccgtgagcgctcacgtgtt
tgcaacagccctgagccccagtatggagggaaggactgtgtcggggatgtgacagaacac
caaatgtgcaacaagagaagctgccctattgatgggtgcttatccaacccgtgttttcct
ggagccaagtgcaacagcttccctgatgggtcctggtcctgtggctcctgcccagtgggc
tttctgggcaatggtacccactgtgaggacctggatgagtgtgctgtggtcacagatatt
tgcttctcaactaacaaagctccccgctgtgtcaacaccaacccgggcttccactgcctg
ccttgtccaccacgctacaaggggaaccaacccttcggtgttggcctggaggatgctagg
acagaaaaacaagtgtgtgagccagagaatccatgtaaggacaagactcacagctgccac
aagaatgcagagtgcatctacctgggccactttagtgaccccatgtacaagtgtgagtgc
cagattggctacgcaggtgatgggctcatctgcggggaggactcagacctggatggctgg
cccaacaacaacctggtgtgtgctactaatgccacctaccactgcatcaaggacaactgc
cccaaactgccaaattccgggcaggaggattttgataaggatggaatcggagatgcttgt
gacgaggacgatgacaatgacggtgtgagcgatgagaaggacaattgccagcttctcttc
aatccccgtcaattagactatgacaaggatgaggttggagaccgctgtgacaactgcccc
tatgtgcacaacccagcacagatcgacacagacaacaatggcgagggggatgcctgctct
gtggacattgacggagacgatgttttcaatgagcgagacaattgtccatatgtctacaac
actgaccagagagatacggatggtgatggcgtgggtgaccactgtgacaattgtcctctg
atgcacaacccagatcagatcgatcaggacaatgatctcgttggagaccagtgtgacaac
aatgaggacatagatgatgacggccaccagaacaaccaagacaactgcccatacatctcc
aactccaaccaggctgaccatgacaacgacggcaagggcgatgcctgcgactctgatgat
gacaatgatggtgttccagatgacagggacaactgtcggcttgtgttcaacccagaccag
gaagactcggacggtgacggccgaggtgacatttgtaaagatgactttgacaatgataat
gtcccagatattgatgatgtgtgccctgagaacaatgccatcactgagacagacttcaga
aacttccagatggtccctctggatcccaaggggaccacacaaattgatcccaactgggta
attcgtcaccaaggcaaagagctggtgcagacagcaaactcagaccctggcatcgctgta
ggtttcgacgagtttgggtctgtggacttcagtggcactttctatgtcaacactgaccgg
gatgatgactacgctggctttgtctttggctatcagtcaagcagccgcttctatgtggtg
atgtggaagcaggtgacccagacctactgggaagacaagcccagtcgggcttacggctac
tctggtgtgtcactcaaagtggtaaactccacgactggtactggcgagcacctgaggaat
gccctgtggcacacgggaaacacagaaggccaggtccggactctatggcatgaccccaaa
aacattggctggaaagactacactgcctacaggtggcacctgattcacaggcctaagaca
ggctacatgagagtcttagtgcatgaaggaaagcaagtcatggctgactcaggaccaatt
tatgaccaaacctacgctggtggacggctgggcctgtttgtcttctcccaagagatggtc
tatttctcggacctcaagtatgagtgcagagatgcctag

DBGET integrated database retrieval system