KEGG   Mus musculus (mouse): 21826Help
Entry
21826             CDS       T01002                                 

Gene name
Thbs2, TSP2, Thbs-2
Definition
thrombospondin 2
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
mmu  Mus musculus (mouse)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    21826 (Thbs2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    21826 (Thbs2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    21826 (Thbs2)
  Cellular commiunity
   04510 Focal adhesion
    21826 (Thbs2)
 Human Diseases
  Infectious diseases
   05144 Malaria
    21826 (Thbs2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   21826 (Thbs2)
  Exosomal proteins of colorectal cancer cells
   21826 (Thbs2)
  Exosomal proteins of bladder cancer cells
   21826 (Thbs2)
Heparan sulfate/heparin binding proteins [BR:mmu00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  21826 (Thbs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
17 A3-B; 17 8.95 cM
AA seq 1172 aa AA seqDB search
MLWALALLALGIGPRASAGDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRF
DYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGP
GDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFY
EQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGAEVNTISEH
TETLHLSPHITTDLVVQGVEKAQEVCTHSCEELSNMMNELSGLHVMVNQLSKNLERVSSD
NQFLLELIGGPLKTRNMSACVQEGRIFAENETWVVDSCTTCTCKKFKTVCHQITCSPATC
ANPSFVEGECCPSCSHSADSDEGWSPWAEWTECSVTCGSGTQQRGRSCDVTSNTCLGPSI
QTRTCSLGKCDTRIRQNGGWSHWSPWSSCSVTCGVGNVTRIRLCNSPVPQMGGKNCKGSG
RETKPCQRDPCPIDGRWSPWSPWSACTVTCAGGIRERSRVCNSPEPQYGGKDCVGDVTEH
QMCNKRSCPIDGCLSNPCFPGAKCNSFPDGSWSCGSCPVGFLGNGTHCEDLDECAVVTDI
CFSTNKAPRCVNTNPGFHCLPCPPRYKGNQPFGVGLEDARTEKQVCEPENPCKDKTHSCH
KNAECIYLGHFSDPMYKCECQIGYAGDGLICGEDSDLDGWPNNNLVCATNATYHCIKDNC
PKLPNSGQEDFDKDGIGDACDEDDDNDGVSDEKDNCQLLFNPRQLDYDKDEVGDRCDNCP
YVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL
MHNPDQIDQDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNSNQADHDNDGKGDACDSDD
DNDGVPDDRDNCRLVFNPDQEDSDGDGRGDICKDDFDNDNVPDIDDVCPENNAITETDFR
NFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDR
DDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDKPSRAYGYSGVSLKVVNSTTGTGEHLRN
ALWHTGNTEGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKTGYMRVLVHEGKQVMADSGPI
YDQTYAGGRLGLFVFSQEMVYFSDLKYECRDA
NT seq 3519 nt NT seq  +upstreamnt  +downstreamnt
atgctctgggcactggccctgctggctctgggcatagggccaagagcttctgctggtgac
cacgtcaaggacacttcatttgaccttttcagcatcagcaacattaaccggaagaccatc
ggtgccaagcagttccgagggcctgaccccggggtgcccgcctaccgttttgtacggttt
gactacatccccccagtgaacacagatgatctcaacaggattgtcaagcttgcaaggaga
aaggagggcttcttcctcacagcccaactgaagcaggaccgcaagtctcggggaacgctc
ctggtgttggaaggccccggcacctcccagaggcagtttgagattgtgtccaatggccca
ggggacactttggacctcaactactgggtagaaggcaatcagcataccaacttcctggag
gatgtgggcctggctgactcccagtggaagaatgtgactgtgcaggtggccagtgacacc
tatagcctgtatgtgggctgcgatcttatcgacagtgtcaccctggaagaaccattctat
gagcagctagaagtagacaggagcaggatgtacgtggccaaaggtgcatctcgagagagt
cacttcaggggcttgctgcagaatgtccatctcgtgtttgcagattctgtggaagatatc
ttaagcaagaaaggctgtcaacacagccagggagctgaagtcaacaccatcagtgaacat
acagagactctccatctgagccctcacatcaccacagatctcgtggtccagggtgtggag
aaggcacaggaggtgtgtacgcactcctgcgaggagttgagcaacatgatgaatgagctc
tctggactgcacgtcatggtgaaccagctgagcaagaacctggagagagtgtctagtgat
aaccagttccttttggagctcattgggggccctctgaagacaagaaacatgtcagcctgt
gtgcaggagggccgaatctttgcagaaaatgaaacctgggttgtggatagttgtaccaca
tgcacctgcaagaaatttaaaacagtctgccatcagatcacctgctcacctgcaacttgt
gccaacccatcttttgtggaaggcgagtgctgtccatcctgttcacactctgcagacagt
gatgagggctggtctccgtgggcagagtggaccgagtgttctgtcacctgtggctctggg
acccagcagagaggccggtcttgtgatgtcaccagcaacacctgcctgggcccctccatt
cagacaaggacatgcagcctgggcaaatgtgatacgagaatccgtcagaatggaggctgg
agtcactggtcaccctggtcttcatgctccgtgacttgtggagttggcaatgtcacccgc
atacgtctctgcaactcaccagtgccccagatgggtggcaagaactgcaagggcagcggc
cgggaaaccaaaccctgtcagcgtgatccgtgcccaattgatggccgctggagcccctgg
tccccttggtcagcctgcacagttacctgtgctggagggatccgtgagcgctcacgtgtt
tgcaacagccctgagccccagtatggagggaaggactgtgtcggggatgtgacagaacac
caaatgtgcaacaagagaagctgccctattgatgggtgcttatccaacccgtgttttcct
ggagccaagtgcaacagcttccctgatgggtcctggtcctgtggctcctgcccagtgggc
tttctgggcaatggtacccactgtgaggacctggatgagtgtgctgtggtcacagatatt
tgcttctcaactaacaaagctccccgctgtgtcaacaccaacccgggcttccactgcctg
ccttgtccaccacgctacaaggggaaccaacccttcggtgttggcctggaggatgctagg
acagaaaaacaagtgtgtgagccagagaatccatgtaaggacaagactcacagctgccac
aagaatgcagagtgcatctacctgggccactttagtgaccccatgtacaagtgtgagtgc
cagattggctacgcaggtgatgggctcatctgcggggaggactcagacctggatggctgg
cccaacaacaacctggtgtgtgctactaatgccacctaccactgcatcaaggacaactgc
cccaaactgccaaattccgggcaggaggattttgataaggatggaatcggagatgcttgt
gacgaggacgatgacaatgacggtgtgagcgatgagaaggacaattgccagcttctcttc
aatccccgtcaattagactatgacaaggatgaggttggagaccgctgtgacaactgcccc
tatgtgcacaacccagcacagatcgacacagacaacaatggcgagggggatgcctgctct
gtggacattgacggagacgatgttttcaatgagcgagacaattgtccatatgtctacaac
actgaccagagagatacggatggtgatggcgtgggtgaccactgtgacaattgtcctctg
atgcacaacccagatcagatcgatcaggacaatgatctcgttggagaccagtgtgacaac
aatgaggacatagatgatgacggccaccagaacaaccaagacaactgcccatacatctcc
aactccaaccaggctgaccatgacaacgacggcaagggcgatgcctgcgactctgatgat
gacaatgatggtgttccagatgacagggacaactgtcggcttgtgttcaacccagaccag
gaagactcggacggtgacggccgaggtgacatttgtaaagatgactttgacaatgataat
gtcccagatattgatgatgtgtgccctgagaacaatgccatcactgagacagacttcaga
aacttccagatggtccctctggatcccaaggggaccacacaaattgatcccaactgggta
attcgtcaccaaggcaaagagctggtgcagacagcaaactcagaccctggcatcgctgta
ggtttcgacgagtttgggtctgtggacttcagtggcactttctatgtcaacactgaccgg
gatgatgactacgctggctttgtctttggctatcagtcaagcagccgcttctatgtggtg
atgtggaagcaggtgacccagacctactgggaagacaagcccagtcgggcttacggctac
tctggtgtgtcactcaaagtggtaaactccacgactggtactggcgagcacctgaggaat
gccctgtggcacacgggaaacacagaaggccaggtccggactctatggcatgaccccaaa
aacattggctggaaagactacactgcctacaggtggcacctgattcacaggcctaagaca
ggctacatgagagtcttagtgcatgaaggaaagcaagtcatggctgactcaggaccaatt
tatgaccaaacctacgctggtggacggctgggcctgtttgtcttctcccaagagatggtc
tatttctcggacctcaagtatgagtgcagagatgcctag

DBGET integrated database retrieval system