KEGG   Mus musculus (mouse): 218268Help
Entry
218268            CDS       T01002                                 

Gene name
Eif4e1b, Eif4eloo, Gm273
Definition
(RefSeq) eukaryotic translation initiation factor 4E family member 1B
  KO
K03259  
translation initiation factor 4E
Organism
mmu  Mus musculus (mouse)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    218268 (Eif4e1b)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    218268 (Eif4e1b)
   04151 PI3K-Akt signaling pathway
    218268 (Eif4e1b)
   04150 mTOR signaling pathway
    218268 (Eif4e1b)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    218268 (Eif4e1b)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     218268 (Eif4e1b)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     218268 (Eif4e1b)
Translation factors [BR:mmu03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    218268 (Eif4e1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
13; 13 B1
AA seq 244 aa AA seqDB search
MNKVEGGGHKEEVVVKEKEVVKEKPSEATAEGVQAGEAKDLPGSLKTQRRKAHREHPPEV
LSKLHPLQYRWVLWFFKNDRSRAWQDNLQLVTKFNTVEDFWAVYSHIKLASKLSSGCDYA
LFKEGILPMWEDNRNKQGGRWLLSIDKQLRHFELDRLWLETLLCLVGNCFEEYSREVCGA
VVNIRTKRDKIALWTSEAEDKAGVMQIGQIYKERLGISTKTIIGYQAHADTAAKSNNLAN
KFVV
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagttgagggtggagggcataaggaggaggtggtggtgaaagaaaaggaggta
gtgaaagaaaagccatcagaagcaactgcggagggagtccaagcaggagaagccaaagac
cttcctggctcccttaagactcagaggaggaaggcccacagagaacatccaccagaggtc
ctgagcaagctacaccccttgcagtacaggtgggttctgtggttcttcaagaatgaccga
agccgggcctggcaggacaacctgcagctagtcaccaagtttaacactgtggaggacttc
tgggcggtgtacagccatatcaagctggccagcaagctctcttccggctgtgactatgcc
ctgttcaaggaaggcatcctgcccatgtgggaagacaacagaaacaagcagggtggccgc
tggctgctcagcattgacaaacaactgcgccacttcgaactggaccgtctgtggctggag
acgttgctgtgtctggttgggaattgttttgaggaatacagcagggaagtgtgcggtgct
gtcgtgaacatccgcacgaagagggacaagattgccctgtggacgagtgaagcagaggac
aaagccggagtgatgcagatcgggcaaatatacaaagagcgcctgggcatctctacgaag
accatcattgggtaccaggcccatgcagacactgctgccaagagcaacaacttagcaaac
aagtttgtggtgtga

DBGET integrated database retrieval system