KEGG   Mus musculus (mouse): 21828Help
Entry
21828             CDS       T01002                                 

Gene name
Thbs4, TSP4
Definition
thrombospondin 4
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
mmu  Mus musculus (mouse)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    21828 (Thbs4)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    21828 (Thbs4)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    21828 (Thbs4)
  Cell communication
   04510 Focal adhesion
    21828 (Thbs4)
 Human Diseases
  Infectious diseases
   05144 Malaria
    21828 (Thbs4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   21828 (Thbs4)
  Exosomal proteins of colorectal cancer cells
   21828 (Thbs4)
  Exosomal proteins of bladder cancer cells
   21828 (Thbs4)
Heparan sulfate/heparin binding proteins [BR:mmu00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  21828 (Thbs4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
13 C3; 13 47.75 cM
AA seq 963 aa AA seqDB search
MPAPRAAAAAFLLLHLVLQPWQRTSAQATPQVFDLLPSSSQRLNPSALQPVLTDPTLHEV
YLISTFKLQSKSSATIFGLYSSSDNSKYFEFTVMGRLNKAILRYLKNDGKIHLVVFNNLQ
LADGRRHRVLLRLSNLQRGDGSVELYLDCAQADSVRNLPRAFSGLTQNPESIELRTFQRK
PQDFLEELKLVVRGSLFQVASLQDCFLQQSEPLAATSTGDFNRQFLGQMTQLNQLLGEVK
DLLRQQVKETSFLRNTIAECQACGPLSFQSPTPNTLVPIAPPAPPTRPTRHCDSSPCFRG
VRCTDTRDGFQCGPCPDGYTGNGITCSDVDECKYHPCYPGVRCVNLAPGFRCDACPVGFT
GPMVQGVGINFAKTNKQVCTDVDECQNGACVLNSICINTLGSYRCGPCKPGYTGDQTRGC
KTERSCRNPEQNPCSVHAQCIEERQGDVTCVCGVGWAGDGYVCGKDVDIDSYPDEELPCS
ARNCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDGILNEQDNCVLTHNIDQRNSDKDI
FGDACDNCRMVLNNDQKDTDGDGRGDACDDDMDGDGIKNILDNCPRVPNRDQQDRDGDDV
GDACDSCPDVSNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSSQLDTDKDG
IGDECDDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNNDGVGDICEADFDQDQVIDHIDV
CPENAEITLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNG
VDFEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKA
VKSKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRF
YEGSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQSFDR
LDN
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atgccggccccacgcgcggccgcggccgccttcctcctgctgcacctggtcctgcagccg
tggcagcggacgagcgcccaggccacaccccaggtctttgatcttctaccgtcctccagc
cagaggctgaaccccagcgccctgcagccagtcctgacagatcccaccctgcacgaagtc
tatctcatctccaccttcaagctgcagagtaaaagctcagccaccatctttggcctctac
tcctcaagtgacaacagcaaatactttgaattcactgtgatgggacggctgaacaaagcc
atcctccgctacctgaagaatgatggaaagatccatctggtggtgttcaacaacttgcag
ctggctgatgggaggcgccacagggttctcctgagactgagcaatttgcagagaggagat
ggctctgtagaactctacctggactgcgctcaggcggactcggtgcgcaacctccccaga
gccttttctggcctcacccagaacccagagtccattgaattgcggacattccagaggaag
ccccaggacttcttggaagagctgaagctggtggtgcggggctcgctgttccaggtggcc
agcctccaagactgcttcctgcagcagagtgagcctctggctgccacaagcacaggagac
tttaatcgacagttcttgggtcaaatgacacaactgaaccagctccttggagaggtgaaa
gatcttctgaggcagcaggtcaaggaaacatcgtttttgcgaaacaccattgctgaatgc
caagcttgtggtcctctcagctttcagtccccaactccaaacacactggtgcccatagct
cctccagcacccccaactcgcccaacacgccactgtgactccagcccttgtttccgaggt
gtccgatgtacggacaccagggatggcttccagtgtggaccctgcccagatggttacacg
ggaaacgggatcacctgctctgacgtggatgagtgcaaataccatccctgctatccaggt
gtgcgctgtgtgaatttggctccgggtttcagatgtgacgcctgtccagtaggtttcaca
gggcccatggtgcagggtgtcgggatcaactttgctaaaacaaacaagcaggtgtgcact
gatgttgatgagtgtcagaatggagcgtgtgttctgaattctatctgcattaacactttg
ggatcttatcgctgtgggccttgcaaaccagggtacactggtgatcagacgaggggatgc
aagactgaaaggagctgccggaacccagagcagaacccatgcagtgtgcatgcgcagtgc
attgaggagcggcaaggggatgtgacgtgtgtgtgtggtgttggctgggctggtgacggc
tatgtctgtggaaaggatgtggacattgacagttaccctgatgaagaactgccatgctct
gccaggaactgcaagaaggataactgcaagtatgtgccaaactctggccaggaagatgca
gacagagatggcatcggagacgcgtgtgatgaggatgcagatggagatgggatcttgaat
gaacaggacaactgtgtcctgactcacaatatagaccaaaggaacagtgataaagatatc
tttggggatgcctgtgacaactgccggatggtcctgaataatgaccagaaggatactgac
ggggatgggagaggagacgcctgtgatgacgacatggatggagatggaataaaaaacatt
ttggacaactgtcccagagttcccaaccgtgaccagcaggatcgggatggtgatgatgtc
ggagatgcttgtgacagctgtcctgatgtcagtaaccctaaccagtcggatgtggataac
gatctggttggggactcctgtgacaccaaccaagacagtgacggggatggccaccaggac
agcacagacaactgccccacagtcattaacagctcccagctggacactgacaaagatggg
atcggcgatgaatgtgatgacgatgacgataacgatggcatcccagacctggtgcctcct
ggcccagacaactgcaggctcgtccccaacccagcccaggaagatagcaacaatgacggg
gtaggagatatctgtgaagctgacttcgaccaggaccaggtcatcgatcacattgatgtg
tgccctgagaatgcggagatcaccctgactgacttcagggcctaccagacagtggtcctg
gaccctgaaggggatgctcagatcgaccccaactgggtggtcctgaaccagggcatggaa
attgtgcagaccatgaacagtgaccctggcctagctgttgggtacacggcatttaacgga
gttgactttgaagggaccttccacgtaaacacccagacagatgatgactatgctggcttt
atttttggttaccaagacagctccagcttctatgtagtcatgtggaagcaaacggagcag
acatactggcaggctacaccgttccgtgcagtagcagaacctggtattcagctcaaggct
gtgaagtctaaaactggcccaggggaacatctccgaaactccctgtggcacacaggggac
accagcgaccaggtcaggctgctgtggaaggactccaggaatgtgggctggaaggacaag
gtctcctaccgctggttcctgcagcataggccccaggtgggctacatcagggtgcgcttt
tatgaaggctcggagttggtggctgactctggggtcaccatagacaccaccatgcgtgga
ggccgacttggtgtgttctgcttctctcaagaaaacatcatctggtccaacctcaagtac
cgctgcaacgacaccataccagaggacttccaggagttccagacccagagtttcgaccgc
ttggataattga

  All links  
No link information was found.   
DBGET integrated database retrieval system