KEGG   Mus musculus (mouse): 21848Help
Entry
21848             CDS       T01002                                 

Gene name
Trim24, A130082H20Rik, AI447469, D430004I05Rik, TIF1, TIF1-alpha, TIF1alpha, Tif1a
Definition
(RefSeq) tripartite motif-containing 24
  KO
K08881  
tripartite motif-containing protein 24 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     21848 (Trim24)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Atypical group
  TIF1 family [OT]
   21848 (Trim24)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    21848 (Trim24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
6; 6 B1
AA seq 1051 aa AA seqDB search
MEVAVEKAAAAAAPAGGPAAAAPSGENEAESRQGPDSESGGEASRLNLLDTCAVCHQNIQ
SRVPKLLPCLHSFCQRCLPAPQRYLMLTAPALGSAETPPPAPAPAPAPGSPAGGPSPFAT
QVGVIRCPVCSQECAERHIIDNFFVKDTTEVPSSTVEKSNQVCTSCEDNAEANGFCVECV
EWLCKTCIRAHQRVKFTKDHTVRQKEEVSPEAVGVTSQRPVFCPFHKKEQLKLYCETCDK
LTCRDCQLLEHKEHRYQFIEEAFQNQKVIIDTLITKLMEKTKYIKYTGNQIQNRIIEINQ
NQKQVEQDIKVAIFTLMVEINKKGKALLHQLESLAKDHRMKLMQQQQEVAGLSKQLEHVM
HFSKWAVSSGSSTALLYSKRLITYRLRHLLRARCDASPVTNTTIQFHCDPSFWAQNIINL
GSLVIEDKESQPQMPKQNPVVEQSSQPPGGLPSNQLSKFPTQISLAQLRLQHIQQQVMAQ
RQQVQRRPAPVGLPNPRMQGPIQQPSISHQHPPPRLINFQNHSPKPNGPVLPPYPQQLRY
SPSQNVPRQTTIKPNPLQMAFLAQQAIKQWQISSVQAPPTTASSSSSTPSSPTITSAAGY
DGKAFSSPMIDLSAPVGGSYNLPSLPDIDCSSTIMLDNIARKDTGVDHAQPRPPSNRTVQ
SPNSSVPSPGLAGPVTMTSVHPPIRSPSASSVGSRGSSGSSSKPAGADSTHKVPVVMLEP
IRIKQENSGPPENYDFPVVIVKQESDEESRPQNTNYPRSILTSLLLNSSQSSASEETVLR
SDAPDSTGDQPGLHQENSSNGKSEWSDASQKSPVHVGETRKEDDPNEDWCAVCQNGGELL
CCEKCPKVFHLTCHVPTLTNFPSGEWICTFCRDLSKPEVDYDCDVPSHHSEKRKSEGLTK
LTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYCMY
TKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLESYFEELLKNLYPEKRFPKVEFRHEA
EDCKFSDDSDDDFVQPRKKRLKSTEDRQLLK
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggctgtggagaaggcggcggcggcagcggctccggccggaggccccgcagcg
gcggcgccgagcggggagaatgaggccgagagccggcagggcccggactcggagagcggc
ggcgaggcgtcccggctcaacctgttggacacttgcgccgtgtgccaccagaacatccag
agccgggtgcccaagctgctgccctgcctgcactcgttctgccagcgctgtttgcccgcg
ccgcagcgctatctcatgctgacggcgcccgcgctgggctcggcagagacccctccaccc
gctcccgcccccgcccccgccccgggctccccggccggtggtccttcgccattcgccacc
caagttggagtcattcgatgcccagtttgcagtcaagagtgtgctgagagacacatcata
gacaacttttttgtgaaggacaccactgaagttcctagtagtacagtagaaaagtctaat
caggtatgtacaagctgtgaagacaatgcagaagctaatgggttttgtgtagagtgtgtt
gaatggctctgcaagacatgtattagagctcaccagagggtgaagttcacaaaagaccac
acagtcaggcagaaagaagaagtatctccagaggcagttggggtgaccagtcagcgacca
gtgttttgtcccttccataaaaaggagcagttgaaactttactgtgaaacatgtgataaa
ctgacctgtcgagactgccagctgctagaacacaaagaacacaggtatcaatttatagaa
gaagcttttcagaatcaaaaagtgatcatagatactctaatcaccaaactgatggaaaaa
acaaaatatataaagtatacaggaaatcagatccaaaataggataattgaaataaatcaa
aaccaaaagcaggtggaacaggatattaaagttgccatcttcacattgatggtggagata
aacaaaaaagggaaagctctgctgcaccagcttgagagtcttgcaaaggaccatcgaatg
aaactcatgcaacaacagcaggaagtggctgggctttctaagcagttagagcacgtcatg
catttttctaaatgggctgtttccagtggcagcagcacagccttgctgtacagcaagcgg
ctgattacatacaggttacggcaccttcttcgtgcaaggtgtgatgcttctcctgtgacc
aacaccaccatccagtttcactgtgatcctagtttctgggctcaaaatattatcaacttg
ggttctttagtaatcgaggataaagagagccagccacaaatgcctaagcagaatcctgtc
gtggagcagagttcacagccaccaggtggtttaccttccaaccagttatccaagttccca
acacagatcagcctagctcagttacgactccagcatattcagcaacaggtaatggctcag
aggcaacaggtgcaacggaggccagcacctgtgggtttaccaaaccctagaatgcagggg
cccatccagcagccttccatctctcatcagcatccgccaccacgcttaataaactttcag
aatcacagccctaagcccaatggaccagttcttcctccttatcctcagcagctgagatat
tcaccaagccagaatgtacctcggcagacaacaataaagcccaaccccttgcaaatggct
tttttggctcaacaggccataaaacagtggcagatcagcagtgtacaggctccgcccaca
actgccagcagctcctcctccacgccgtccagccccacaatcacaagtgcagctgggtac
gatggaaaagcttttagttcacccatgattgatctgagtgcaccggtgggagggtcttac
aatcttccttctcttccagatattgattgttcaagtactataatgttggacaacattgca
aggaaagacacaggtgtagatcacgcccagccgaggcctccgtcaaacagaacggtgcag
tcaccaaattcatcagtgccatctccaggccttgcagggcctgttactatgactagcgtc
catcccccaatacgttcacctagtgcctccagtgttggaagtcgaggaagctctggctct
tccagcaaaccagcaggagctgattctactcacaaggtcccagtagtcatgctggagcca
attcgaataaaacaggaaaacagtggaccacctgaaaattatgattttcctgttgttata
gtaaaacaagaatcagatgaagaatctagacctcaaaatactaactatccaagaagcata
cttacctccctcctcttaaacagcagtcagagctctgcttctgaggaaaccgtgttacga
tctgatgcccctgatagtacaggagatcagcctggactccatcaagaaaattcctcaaat
ggaaagtctgagtggtcggatgcctcccagaagtcccctgtgcatgtcggagagacgagg
aaggaggatgaccccaatgaagactggtgtgctgtttgtcaaaatggtggggaactccta
tgctgtgagaaatgtcctaaagtattccatcttacttgtcatgtgcccaccttgacaaat
tttccaagtggagaatggatctgtactttctgccgagacttatctaagccagaggttgac
tatgattgtgatgttcccagtcaccactcagagaaacggaaaagtgaaggccttactaag
ttaacgccaatagacaaaaggaaatgtgaacgcctacttctgtttctttactgccatgaa
atgagcctggctttccaagaccctgttcctctaactgtgcctgattattataaaataatt
aaaaacccaatggacttgtcaaccatcaagaaaagacttcaggaggattattgcatgtat
acaaagcctgaagactttgtagctgattttagattgatctttcaaaactgtgctgaattc
aatgagcctgattctgaagtagccaatgctggtataaaacttgaaagctattttgaagaa
cttctaaagaatctttatccagaaaaaaggtttcctaaggtagaattcaggcatgaagca
gaagactgtaagttcagtgacgactcagacgatgactttgtacagccccggaagaagcgt
ctcaagagcaccgaggatcgccagctgcttaagtaa

DBGET integrated database retrieval system