KEGG   Mus musculus (mouse): 218699Help
Entry
218699            CDS       T01002                                 

Gene name
Pxk, C230080L11Rik, D14Ertd813e, MONaKA
Definition
(RefSeq) PX domain containing serine/threonine kinase
  KO
K17543  
PX domain-containing protein kinase-like protein
Organism
mmu  Mus musculus (mouse)
Brite
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Other group
  Slob family
   218699 (Pxk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
14 A1; 14 4.7 cM
AA seq 582 aa AA seqDB search
MAFMEKPPAGKVLLDDTVPLTAAVEASQSLQSHTEYIIRVQRGISAENSWQIVRRYSDFD
LLNNSLQITGLSLPLPPKKLIGNMDREFIAERQRGLQNYLNVIMANHVLSNCELLKKFLD
PNNYSANYTEIALQQVSMFFRSEPKWEVVEPLKDIGWRIRKKYFLMKIKNQPKERLVLSW
ADLGPDKYLSDKDFQCLIKLLPSCVHPYIYRVTFATASESSALLIRAFNEKGTLKDLIYK
AKPKDPFLKKYCNPKKTQGLELQQIKTYGRQILEALKFLHDKGFPYGHLHAANVMLDGNT
CRLLDLENSLLGLPSFYRSYFTQFRKINTLESVDVHCFGHLLYEMTYGRPPDSVPVDSFP
PASSLAVVAVLESTLSCEACKNGMPTVSRLLQMPLFSDVLLTTSEKPQFKIPTKLKEALR
IAKECIEKRLTEEQKQIHQHRRLTRAQSHHGSEEERKRRKILARKKSKRSAVENSEEQPV
KHSNSNNSAGSGASSPLTSPSSPTPPSTAGLSSALPPPPPPPPPPPPPAGPSPTSATEMP
APFLPQPVNGVNRGALLSSIQNFQKGTLRKAQTCDHSAPKIG
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggccttcatggagaagccgccggctggcaaggtgctgctggacgacacggtgccgctg
acagcggccgtcgaggcgagccagagtctgcagtcgcacacggaatatatcatccgggtg
caaagaggaatttctgcagaaaacagctggcagatcgtcagaagatacagtgacttcgat
ctgcttaacaacagcttgcaaattacaggcctgagcctgcctcttcctcctaagaaactg
attggaaacatggaccgtgagttcatcgctgagaggcagcgaggcctgcagaactacctt
aacgtcatcatggcaaatcatgtcttgtccaactgtgagctgcttaagaagttcctagac
ccaaacaactattctgcaaactatactgagatcgccttacagcaggtttccatgttcttc
cgatcagaaccaaagtgggaggtggtagaaccactgaaggacataggttggaggataagg
aagaaatatttcttgatgaaaataaaaaaccaaccaaaggagcggctggtgctaagctgg
gctgatcttggcccagacaagtacttgtcagataaagattttcagtgtctaatcaaactt
ctgccttcctgtgtgcacccttacatctatcgggtcacctttgccacggctagcgagtcc
tccgcattgctgattagagcctttaatgagaagggaactttgaaggatctgatctacaag
gcaaaaccaaaggaccccttcctaaagaaatactgcaaccctaagaaaacccagggcctt
gaactccagcaaataaaaacatatgggcggcagatattagaggcactaaagtttcttcat
gacaagggattcccttacggccacctccatgcagccaatgtgatgctggatggcaacact
tgccggctgctagacctcgaaaactcactgctgggtctgccttccttctaccgatcctac
ttcacacaattcaggaaaatcaatacattggagagtgtagatgtgcactgttttggccac
ttactctatgaaatgacttatggacgacctcccgactccgtgcctgtggactcctttcct
cctgcatcatccttggctgtggtggccgtattggagtctacgctgtcttgtgaagcctgt
aaaaatggcatgcctaccgtctcccggctcttacagatgccattattcagtgatgtttta
ctaacaacttctgaaaagccacagtttaagattcccacaaaactaaaagaggcattgcga
attgccaaggaatgcatagagaagagactcaccgaggaacagaagcagattcaccagcat
cgaagactaacgagagcccagtcacaccatgggtctgaggaagaaaggaaaaggagaaag
atcttagctcgaaagaagtcaaaacgatctgctgttgaaaacagtgaggagcagccagtg
aagcacagtaactccaataactcagcaggatctggggccagctcacctctcacatcccca
tcatctccaactccaccctccacagcaggactgtcttcagcattacctccacctcctccg
ccacctcctcctccacctccaccagcaggtccctcgccaacctcagccacggagatgcct
gctccgttcctgccccagcctgtgaatggtgtgaaccgtggggccttgctcagttccatc
cagaatttccaaaagggaactttgcggaaagcccaaacctgtgatcacagcgctcccaag
atcggctga

DBGET integrated database retrieval system