KEGG   Mus musculus (mouse): 21872Help
Entry
21872             CDS       T01002                                 

Gene name
Tjp1, ZO1
Definition
(RefSeq) tight junction protein 1
  KO
K05701  
tight junction protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
Adherens junction
Tight junction
Gap junction
Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    21872 (Tjp1)
   04530 Tight junction
    21872 (Tjp1)
   04540 Gap junction
    21872 (Tjp1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    21872 (Tjp1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     21872 (Tjp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7 C; 7 35.02 cM
AA seq 1685 aa AA seqDB search
MSARAAAAKSTAMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVL
KGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSHPD
PEPVSDNEDDSYDEEVHDPRAGRGALANRRSEKSWARDRSASRERSLSPRSDRRSVASSQ
PAKPTKVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENM
SLTDAKTLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHS
GRSHDRPPRRSQSRSPDQRSEPSDHSTQSPQQPSNGSLRSREEERMSKPGAISTPVKHVD
DHPPKAVEEVTVEKNEKQTPTLPEPKPVYAQVGQPDVDLPVSPSDGALPNSAHEDGILRP
SMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIR
EEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKG
EVFRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRAD
FWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREK
LAREEPDIYQIAKSEPRDAGTDHRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQ
WYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMND
GWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHT
SDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHENQTYPPYSP
QAQPQAIHRIDSPGLKPASQQVYRKEPYSEEMMRQNHILKQPALGHPGQRPDKEPNLAYE
PQLPYIEKQASRDLEQPSYRYEVSSYTDQFSRNYDHRLRFEDRIPTYEDQWSYYDDKQPY
QPRPFENQHPRDLDSRQHPEEASERGYFQRFEEPAPLSYDSRTRYEQLPRTSTLRHEEQP
APAYEVHNRYRPEAQPYSSTGPKSSEPKQYFDQYPRSYEQVPPPGFTSKTGHYEPLHGAA
VVPPLIPSSQQKPEVLPSATKPQPPPPTLTEEEEDPAMKPQSVLTRVKMFENKRSASLEN
KKDVNDTASFKPPEVASKPPGASLAGPKPVPQSQFSEHDKTLYRLPEPQKPQVKPPEDIV
RSNHYDPEEDEEYYRKQLSYFDRRSFESKPSAHLPAGHHSEPAKPVHSQSQPNFSSYSSK
GKPETDAVDRSFSEKRYDPAQATPPPPPLPSQYSQPAPPLSSSSLHIHSKGAQGEGNSVS
LDFQNSYMSKPDPPPSQSKPATFRPPTREDPPQTFYPQKSFPDKAPVNGAEQTQKTITPV
YNRFTPKPYTSSARPFERKFESPKFNHNLLPSETVHKPELSSKTPTSPKTLMKAHSSTQP
PEFDSGVETFSVHTDKPKYQMNNISTMPKAVPVSPSAVEEDEDEDGHTVVATARGIFNSN
GGVLSSIETGVSIIIPQGAIPEGIEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPH
GLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGDPKTWQNKCLPGDPNYLVGANCVSV
LIDHF
NT seq 5058 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccagggccgcggccgctaagagcacagcaatggaggaaacagctatatgggaa
cagcacacagtgacgcttcacagggctcctgggtttggatttggaattgcaatctctggt
ggaagagataatcctcattttcagagtggggaaacctccatagtgatttctgatgtgtta
aaaggagggccagctgaaggacagctacaggaaaatgaccgagttgcaatggttaacgga
gtttcaatggataacgttgaacatgcttttgctgttcagcagctaaggaagagtgggaaa
aacgcaaaaattactatccgaaggaagaagaaagttcagatccctgtaagtcacccagat
cctgagccggtgtctgataatgaagacgatagttatgacgaagaagtgcatgacccaaga
gctggccgcggtgctttagcgaacagaaggagcgagaagagctgggcaagggataggagt
gcaagcagggagaggagcctgtcccctcgctcggacaggcggtccgtggcctccagtcag
cccgcaaagcccaccaaggtcacactggtgaagtctcggaaaaatgaagaatatggtctt
cgattggccagccatatatttgtaaaggaaatttcacaagatagtttggcagcaagagat
ggtaacattcaagaaggggatgttgtcttgaagataaatggtactgtgacagaaaatatg
tcattgacagatgcaaaaacactgatagaaaggtctaaaggcaagttaaaaatggtagtg
caaagagatgagcgggctaccttactgaacgtccctgacctttcggatagtatccattct
gctaatgcctcggaaagagatgacatttcagaaattcagtcactagcatcagaccattca
ggtcgctcgcatgacaggccaccccgccgcagccagtcacgatctcctgaccaacgttca
gagccctccgatcattccacgcagtctccacagcagcccagcaatggcagtctccggagc
agagaggaagagcgaatgtctaaacctggggccatctcaactcctgtaaaacatgtagac
gatcatccacccaaagcagtggaagaagttacagttgagaaaaatgagaagcagacgccc
actcttccagaaccgaaacctgtgtatgctcaagttggacaaccagatgtggatttaccc
gtcagcccttctgatggtgctctgcctaattcagctcatgaagacgggatacttaggccc
agcatgaaactggtaaaattcagaaaaggagatagtgtgggtttgcgactagctggtgga
aatgatgtcggaatatttgtagctggcgttctagaagatagccctgcagccaaagaaggc
ttagaggaaggtgatcaaattctcagggtgaacaatgtagatttcacaaatatcataagg
gaagaggccgtccttttcctccttgacctccctaaaggtgaagaagtgaccatactggct
cagaagaagaaggacgtttatcgccgcattgtagaatcagatgtaggagattcattctat
attagaacgcattttgaatatgaaaaagaatctccttacggacttagttttaacaaagga
gaggtgttccgggtcgtggatactttatacaatggaaagctgggctcttggcttgccatt
cgaattggcaaaaatcataaggaggtagaacgaggcatcatccctaataagaacagagct
gaacagttagccagtgtacagtacacacttccaaagacagcgggtggtgatcgggcagac
ttctggaggtttcgaggtcttcgcagctccaagagaaatcttcgaaaaagcagagaggac
ttgtcagctcagccagttcaaactaagttcccagcttatgaaagggttgttcttcgagaa
gctggattcctaagacctgtaaccatctttggaccaatagctgatgttgccagagaaaag
ttggcaagagaggagccagatatctatcagattgcaaaaagtgaaccacgagatgctggg
actgaccatcgtagctctggcatcattcgccttcatacaataaagcaaatcatagatcag
gataaacatgctttattagatgtaacgccaaatgcggttgatcgtcttaattatgcgcag
tggtatccaattgttgtgttccttaaccctgactctaagcaaggtgtaaaaacaatgagg
atgaggttgtgtccggagtctcggaaaagcgccaggaagctatatgaacgctctcataag
cttcgtaagaacaatcaccatctcttcacaactacaattaacttaaactcaatgaatgat
ggttggtacggtgccctgaaagaagcgattcagcagcaacagaaccagctggtgtgggtc
tctgaggggaaggcggatggtgctacaagtgatgaccttgatttgcatgacgatcgtctg
tcctacctgtcagccccaggtagtgagtactcaatgtatagcacggacagtagacacact
tctgactatgaagacacagatacagaaggcggggcctacactgatcaagaactagatgaa
actcttaatgatgaggtggggactcccccggagtctgccattacacggtcctctgagcct
gtaagagaggattcctctggaatgcatcatgaaaaccagacataccctccttactcacca
caagcgcagccacaagctattcatagaatagactcccctggacttaagccagcctctcaa
caggtgtacaggaaggagccgtattctgaagaaatgatgagacaaaaccatattttaaaa
caaccagctcttggtcacccagggcagaggccagataaagagccaaatctagcctatgaa
ccccaacttccatatatagaaaaacaagccagcagagaccttgagcagccgtcatacagg
tatgaggtctcaagctacacagaccagttttctcggaactatgaccatcgcctacggttt
gaagatcgaatccctacctatgaagaccagtggtcatattatgatgacaaacagccctac
caacctcggccttttgagaatcagcatccccgagacctggactccagacaacatcccgaa
gaggcttcagaacgaggttatttccagcgttttgaagagccagcccctctgtcgtacgac
agtagaacacgctatgagcagctgcctcgaacctctactctacgacatgaagagcagcca
gcccctgcatatgaggtgcacaacaggtacaggccagaggcacagccctattcttcaaca
ggccctaagtcatctgagcccaagcagtactttgaccagtacccgcgaagttatgagcaa
gttccaccaccaggctttacctccaaaacaggccattacgagcctctccatggtgctgca
gttgtccctcctctgataccttcctctcaacaaaagccagaagtcctgccctcggctacc
aaaccacagcctccacccccaaccctaactgaggaggaggaggatccagcaatgaaacca
cagtctgtgctcaccagagtcaaaatgtttgaaaacaaaagatctgcgtctttggagaac
aagaaagatgtgaatgacactgccagctttaagcctccggaagtagcatctaaacctcca
ggtgcttctcttgctggccctaaacctgtccctcagagtcagtttagtgagcacgacaaa
acgctctacaggctcccagagcctcagaaacctcaagtgaagccacccgaagatattgtt
cgatcaaatcattacgaccctgaagaggatgaagaatattaccggaaacagctctcctac
tttgaccgaagaagttttgagagcaagccttctgcacatcttcctgctggccatcactca
gagcctgctaagccagtccattctcagagccagcccaacttctctagttactcttcaaag
ggaaaacccgaaactgatgctgtggatagatcattcagtgagaaacgttatgatccagcc
caggccacgcctcctcctcctccgttgccctcacagtacagccagccagctccacctctg
tccagctcttctctccacatacattccaagggcgcccagggtgaaggcaactcagtatca
ttggattttcagaactcatatatgtccaaaccagacccacccccatctcagagtaaacca
gcaactttcagaccaccaactcgagaagacccccctcagactttctatccgcagaaaagt
ttcccagacaaagctccagttaacggagctgagcagactcagaaaaccatcactccggtg
tacaatcgattcacaccaaagccgtacacaagttctgcccggccatttgaacgcaaattt
gaaagtccgaagttcaaccataatcttctgccaagtgaaactgtacataaacctgaattg
tcttcaaaaactcccacttccccaaaaactcttatgaaagctcatagttcaacacagcct
ccagagtttgacagtggagttgaaactttctctgttcacacagataagcctaaatatcaa
atgaataatatcagcaccatgcctaaagctgtccctgtgagtccttcagctgtggaagaa
gatgaagatgaggatggtcatactgtagtggctacagctcgtggcatttttaacagcaat
ggtggtgtgttgagttccatagaaaccggtgttagtataattatcccacaaggagccatt
cctgaaggaattgagcaagaaatctatttcaaagtctgcagagacaatagcattctccca
cctttagataaagagaaaggtgaaactctgctgagccccctagtgatgtgtgggccccat
ggcctcaagttcctgaagcccgtggagctacgcttgccacactgtgcgtccatgactcct
gacggttggtcttttgctctaaaatcatccgactcctcgtcgggtgaccctaaaacctgg
caaaacaagtgtcttcctggagatccgaattaccttgttggagccaactgtgtttctgtc
ctgattgaccacttttaa

DBGET integrated database retrieval system