KEGG   Mus musculus (mouse): 21872Help
Entry
21872             CDS       T01002                                 

Gene name
Tjp1, ZO1
Definition
tight junction protein 1
Orthology
K05701  
tight junction protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
Adherens junction
Tight junction
Gap junction
Salmonella infection
Class
Cellular Processes; Cell communication; Adherens junction [PATH:mmu04520]
Cellular Processes; Cell communication; Tight junction [PATH:mmu04530]
Cellular Processes; Cell communication; Gap junction [PATH:mmu04540]
Human Diseases; Infectious diseases; Salmonella infection [PATH:mmu05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7 C; 7 35.02 cM
AA seq 1685 aa AA seqDB search
MSARAAAAKSTAMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVL
KGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSHPD
PEPVSDNEDDSYDEEVHDPRAGRGALANRRSEKSWARDRSASRERSLSPRSDRRSVASSQ
PAKPTKVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENM
SLTDAKTLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHS
GRSHDRPPRRSQSRSPDQRSEPSDHSTQSPQQPSNGSLRSREEERMSKPGAISTPVKHVD
DHPPKAVEEVTVEKNEKQTPTLPEPKPVYAQVGQPDVDLPVSPSDGALPNSAHEDGILRP
SMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIR
EEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKG
EVFRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRAD
FWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREK
LAREEPDIYQIAKSEPRDAGTDHRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQ
WYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMND
GWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHT
SDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHENQTYPPYSP
QAQPQAIHRIDSPGLKPASQQVYRKEPYSEEMMRQNHILKQPALGHPGQRPDKEPNLAYE
PQLPYIEKQASRDLEQPSYRYEVSSYTDQFSRNYDHRLRFEDRIPTYEDQWSYYDDKQPY
QPRPFENQHPRDLDSRQHPEEASERGYFQRFEEPAPLSYDSRTRYEQLPRTSTLRHEEQP
APAYEVHNRYRPEAQPYSSTGPKSSEPKQYFDQYPRSYEQVPPPGFTSKTGHYEPLHGAA
VVPPLIPSSQQKPEVLPSATKPQPPPPTLTEEEEDPAMKPQSVLTRVKMFENKRSASLEN
KKDVNDTASFKPPEVASKPPGASLAGPKPVPQSQFSEHDKTLYRLPEPQKPQVKPPEDIV
RSNHYDPEEDEEYYRKQLSYFDRRSFESKPSAHLPAGHHSEPAKPVHSQSQPNFSSYSSK
GKPETDAVDRSFSEKRYDPAQATPPPPPLPSQYSQPAPPLSSSSLHIHSKGAQGEGNSVS
LDFQNSYMSKPDPPPSQSKPATFRPPTREDPPQTFYPQKSFPDKAPVNGAEQTQKTITPV
YNRFTPKPYTSSARPFERKFESPKFNHNLLPSETVHKPELSSKTPTSPKTLMKAHSSTQP
PEFDSGVETFSVHTDKPKYQMNNISTMPKAVPVSPSAVEEDEDEDGHTVVATARGIFNSN
GGVLSSIETGVSIIIPQGAIPEGIEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPH
GLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGDPKTWQNKCLPGDPNYLVGANCVSV
LIDHF
NT seq 5058 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccagggccgcggccgctaagagcacagcaatggaggaaacagctatatgggaa
cagcacacagtgacgcttcacagggctcctgggtttggatttggaattgcaatctctggt
ggaagagataatcctcattttcagagtggggaaacctccatagtgatttctgatgtgtta
aaaggagggccagctgaaggacagctacaggaaaatgaccgagttgcaatggttaacgga
gtttcaatggataacgttgaacatgcttttgctgttcagcagctaaggaagagtgggaaa
aacgcaaaaattactatccgaaggaagaagaaagttcagatccctgtaagtcacccagat
cctgagccggtgtctgataatgaagacgatagttatgacgaagaagtgcatgacccaaga
gctggccgcggtgctttagcgaacagaaggagcgagaagagctgggcaagggataggagt
gcaagcagggagaggagcctgtcccctcgctcggacaggcggtccgtggcctccagtcag
cccgcaaagcccaccaaggtcacactggtgaagtctcggaaaaatgaagaatatggtctt
cgattggccagccatatatttgtaaaggaaatttcacaagatagtttggcagcaagagat
ggtaacattcaagaaggggatgttgtcttgaagataaatggtactgtgacagaaaatatg
tcattgacagatgcaaaaacactgatagaaaggtctaaaggcaagttaaaaatggtagtg
caaagagatgagcgggctaccttactgaacgtccctgacctttcggatagtatccattct
gctaatgcctcggaaagagatgacatttcagaaattcagtcactagcatcagaccattca
ggtcgctcgcatgacaggccaccccgccgcagccagtcacgatctcctgaccaacgttca
gagccctccgatcattccacgcagtctccacagcagcccagcaatggcagtctccggagc
agagaggaagagcgaatgtctaaacctggggccatctcaactcctgtaaaacatgtagac
gatcatccacccaaagcagtggaagaagttacagttgagaaaaatgagaagcagacgccc
actcttccagaaccgaaacctgtgtatgctcaagttggacaaccagatgtggatttaccc
gtcagcccttctgatggtgctctgcctaattcagctcatgaagacgggatacttaggccc
agcatgaaactggtaaaattcagaaaaggagatagtgtgggtttgcgactagctggtgga
aatgatgtcggaatatttgtagctggcgttctagaagatagccctgcagccaaagaaggc
ttagaggaaggtgatcaaattctcagggtgaacaatgtagatttcacaaatatcataagg
gaagaggccgtccttttcctccttgacctccctaaaggtgaagaagtgaccatactggct
cagaagaagaaggacgtttatcgccgcattgtagaatcagatgtaggagattcattctat
attagaacgcattttgaatatgaaaaagaatctccttacggacttagttttaacaaagga
gaggtgttccgggtcgtggatactttatacaatggaaagctgggctcttggcttgccatt
cgaattggcaaaaatcataaggaggtagaacgaggcatcatccctaataagaacagagct
gaacagttagccagtgtacagtacacacttccaaagacagcgggtggtgatcgggcagac
ttctggaggtttcgaggtcttcgcagctccaagagaaatcttcgaaaaagcagagaggac
ttgtcagctcagccagttcaaactaagttcccagcttatgaaagggttgttcttcgagaa
gctggattcctaagacctgtaaccatctttggaccaatagctgatgttgccagagaaaag
ttggcaagagaggagccagatatctatcagattgcaaaaagtgaaccacgagatgctggg
actgaccatcgtagctctggcatcattcgccttcatacaataaagcaaatcatagatcag
gataaacatgctttattagatgtaacgccaaatgcggttgatcgtcttaattatgcgcag
tggtatccaattgttgtgttccttaaccctgactctaagcaaggtgtaaaaacaatgagg
atgaggttgtgtccggagtctcggaaaagcgccaggaagctatatgaacgctctcataag
cttcgtaagaacaatcaccatctcttcacaactacaattaacttaaactcaatgaatgat
ggttggtacggtgccctgaaagaagcgattcagcagcaacagaaccagctggtgtgggtc
tctgaggggaaggcggatggtgctacaagtgatgaccttgatttgcatgacgatcgtctg
tcctacctgtcagccccaggtagtgagtactcaatgtatagcacggacagtagacacact
tctgactatgaagacacagatacagaaggcggggcctacactgatcaagaactagatgaa
actcttaatgatgaggtggggactcccccggagtctgccattacacggtcctctgagcct
gtaagagaggattcctctggaatgcatcatgaaaaccagacataccctccttactcacca
caagcgcagccacaagctattcatagaatagactcccctggacttaagccagcctctcaa
caggtgtacaggaaggagccgtattctgaagaaatgatgagacaaaaccatattttaaaa
caaccagctcttggtcacccagggcagaggccagataaagagccaaatctagcctatgaa
ccccaacttccatatatagaaaaacaagccagcagagaccttgagcagccgtcatacagg
tatgaggtctcaagctacacagaccagttttctcggaactatgaccatcgcctacggttt
gaagatcgaatccctacctatgaagaccagtggtcatattatgatgacaaacagccctac
caacctcggccttttgagaatcagcatccccgagacctggactccagacaacatcccgaa
gaggcttcagaacgaggttatttccagcgttttgaagagccagcccctctgtcgtacgac
agtagaacacgctatgagcagctgcctcgaacctctactctacgacatgaagagcagcca
gcccctgcatatgaggtgcacaacaggtacaggccagaggcacagccctattcttcaaca
ggccctaagtcatctgagcccaagcagtactttgaccagtacccgcgaagttatgagcaa
gttccaccaccaggctttacctccaaaacaggccattacgagcctctccatggtgctgca
gttgtccctcctctgataccttcctctcaacaaaagccagaagtcctgccctcggctacc
aaaccacagcctccacccccaaccctaactgaggaggaggaggatccagcaatgaaacca
cagtctgtgctcaccagagtcaaaatgtttgaaaacaaaagatctgcgtctttggagaac
aagaaagatgtgaatgacactgccagctttaagcctccggaagtagcatctaaacctcca
ggtgcttctcttgctggccctaaacctgtccctcagagtcagtttagtgagcacgacaaa
acgctctacaggctcccagagcctcagaaacctcaagtgaagccacccgaagatattgtt
cgatcaaatcattacgaccctgaagaggatgaagaatattaccggaaacagctctcctac
tttgaccgaagaagttttgagagcaagccttctgcacatcttcctgctggccatcactca
gagcctgctaagccagtccattctcagagccagcccaacttctctagttactcttcaaag
ggaaaacccgaaactgatgctgtggatagatcattcagtgagaaacgttatgatccagcc
caggccacgcctcctcctcctccgttgccctcacagtacagccagccagctccacctctg
tccagctcttctctccacatacattccaagggcgcccagggtgaaggcaactcagtatca
ttggattttcagaactcatatatgtccaaaccagacccacccccatctcagagtaaacca
gcaactttcagaccaccaactcgagaagacccccctcagactttctatccgcagaaaagt
ttcccagacaaagctccagttaacggagctgagcagactcagaaaaccatcactccggtg
tacaatcgattcacaccaaagccgtacacaagttctgcccggccatttgaacgcaaattt
gaaagtccgaagttcaaccataatcttctgccaagtgaaactgtacataaacctgaattg
tcttcaaaaactcccacttccccaaaaactcttatgaaagctcatagttcaacacagcct
ccagagtttgacagtggagttgaaactttctctgttcacacagataagcctaaatatcaa
atgaataatatcagcaccatgcctaaagctgtccctgtgagtccttcagctgtggaagaa
gatgaagatgaggatggtcatactgtagtggctacagctcgtggcatttttaacagcaat
ggtggtgtgttgagttccatagaaaccggtgttagtataattatcccacaaggagccatt
cctgaaggaattgagcaagaaatctatttcaaagtctgcagagacaatagcattctccca
cctttagataaagagaaaggtgaaactctgctgagccccctagtgatgtgtgggccccat
ggcctcaagttcctgaagcccgtggagctacgcttgccacactgtgcgtccatgactcct
gacggttggtcttttgctctaaaatcatccgactcctcgtcgggtgaccctaaaacctgg
caaaacaagtgtcttcctggagatccgaattaccttgttggagccaactgtgtttctgtc
ctgattgaccacttttaa

DBGET integrated database retrieval system