KEGG   Mus musculus (mouse): 21872Help
Entry
21872             CDS       T01002                                 

Gene name
Tjp1, ZO1
Definition
tight junction protein 1
Orthology
K05701  
tight junction protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
Adherens junction
Tight junction
Gap junction
Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell communication
   04520 Adherens junction
    21872 (Tjp1)
   04530 Tight junction
    21872 (Tjp1)
   04540 Gap junction
    21872 (Tjp1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    21872 (Tjp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7 C; 7 35.02 cM
AA seq 1685 aa AA seqDB search
MSARAAAAKSTAMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVL
KGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSHPD
PEPVSDNEDDSYDEEVHDPRAGRGALANRRSEKSWARDRSASRERSLSPRSDRRSVASSQ
PAKPTKVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENM
SLTDAKTLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHS
GRSHDRPPRRSQSRSPDQRSEPSDHSTQSPQQPSNGSLRSREEERMSKPGAISTPVKHVD
DHPPKAVEEVTVEKNEKQTPTLPEPKPVYAQVGQPDVDLPVSPSDGALPNSAHEDGILRP
SMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIR
EEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKG
EVFRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRAD
FWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREK
LAREEPDIYQIAKSEPRDAGTDHRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQ
WYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMND
GWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHT
SDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHENQTYPPYSP
QAQPQAIHRIDSPGLKPASQQVYRKEPYSEEMMRQNHILKQPALGHPGQRPDKEPNLAYE
PQLPYIEKQASRDLEQPSYRYEVSSYTDQFSRNYDHRLRFEDRIPTYEDQWSYYDDKQPY
QPRPFENQHPRDLDSRQHPEEASERGYFQRFEEPAPLSYDSRTRYEQLPRTSTLRHEEQP
APAYEVHNRYRPEAQPYSSTGPKSSEPKQYFDQYPRSYEQVPPPGFTSKTGHYEPLHGAA
VVPPLIPSSQQKPEVLPSATKPQPPPPTLTEEEEDPAMKPQSVLTRVKMFENKRSASLEN
KKDVNDTASFKPPEVASKPPGASLAGPKPVPQSQFSEHDKTLYRLPEPQKPQVKPPEDIV
RSNHYDPEEDEEYYRKQLSYFDRRSFESKPSAHLPAGHHSEPAKPVHSQSQPNFSSYSSK
GKPETDAVDRSFSEKRYDPAQATPPPPPLPSQYSQPAPPLSSSSLHIHSKGAQGEGNSVS
LDFQNSYMSKPDPPPSQSKPATFRPPTREDPPQTFYPQKSFPDKAPVNGAEQTQKTITPV
YNRFTPKPYTSSARPFERKFESPKFNHNLLPSETVHKPELSSKTPTSPKTLMKAHSSTQP
PEFDSGVETFSVHTDKPKYQMNNISTMPKAVPVSPSAVEEDEDEDGHTVVATARGIFNSN
GGVLSSIETGVSIIIPQGAIPEGIEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPH
GLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGDPKTWQNKCLPGDPNYLVGANCVSV
LIDHF
NT seq 5058 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccagggccgcggccgctaagagcacagcaatggaggaaacagctatatgggaa
cagcacacagtgacgcttcacagggctcctgggtttggatttggaattgcaatctctggt
ggaagagataatcctcattttcagagtggggaaacctccatagtgatttctgatgtgtta
aaaggagggccagctgaaggacagctacaggaaaatgaccgagttgcaatggttaacgga
gtttcaatggataacgttgaacatgcttttgctgttcagcagctaaggaagagtgggaaa
aacgcaaaaattactatccgaaggaagaagaaagttcagatccctgtaagtcacccagat
cctgagccggtgtctgataatgaagacgatagttatgacgaagaagtgcatgacccaaga
gctggccgcggtgctttagcgaacagaaggagcgagaagagctgggcaagggataggagt
gcaagcagggagaggagcctgtcccctcgctcggacaggcggtccgtggcctccagtcag
cccgcaaagcccaccaaggtcacactggtgaagtctcggaaaaatgaagaatatggtctt
cgattggccagccatatatttgtaaaggaaatttcacaagatagtttggcagcaagagat
ggtaacattcaagaaggggatgttgtcttgaagataaatggtactgtgacagaaaatatg
tcattgacagatgcaaaaacactgatagaaaggtctaaaggcaagttaaaaatggtagtg
caaagagatgagcgggctaccttactgaacgtccctgacctttcggatagtatccattct
gctaatgcctcggaaagagatgacatttcagaaattcagtcactagcatcagaccattca
ggtcgctcgcatgacaggccaccccgccgcagccagtcacgatctcctgaccaacgttca
gagccctccgatcattccacgcagtctccacagcagcccagcaatggcagtctccggagc
agagaggaagagcgaatgtctaaacctggggccatctcaactcctgtaaaacatgtagac
gatcatccacccaaagcagtggaagaagttacagttgagaaaaatgagaagcagacgccc
actcttccagaaccgaaacctgtgtatgctcaagttggacaaccagatgtggatttaccc
gtcagcccttctgatggtgctctgcctaattcagctcatgaagacgggatacttaggccc
agcatgaaactggtaaaattcagaaaaggagatagtgtgggtttgcgactagctggtgga
aatgatgtcggaatatttgtagctggcgttctagaagatagccctgcagccaaagaaggc
ttagaggaaggtgatcaaattctcagggtgaacaatgtagatttcacaaatatcataagg
gaagaggccgtccttttcctccttgacctccctaaaggtgaagaagtgaccatactggct
cagaagaagaaggacgtttatcgccgcattgtagaatcagatgtaggagattcattctat
attagaacgcattttgaatatgaaaaagaatctccttacggacttagttttaacaaagga
gaggtgttccgggtcgtggatactttatacaatggaaagctgggctcttggcttgccatt
cgaattggcaaaaatcataaggaggtagaacgaggcatcatccctaataagaacagagct
gaacagttagccagtgtacagtacacacttccaaagacagcgggtggtgatcgggcagac
ttctggaggtttcgaggtcttcgcagctccaagagaaatcttcgaaaaagcagagaggac
ttgtcagctcagccagttcaaactaagttcccagcttatgaaagggttgttcttcgagaa
gctggattcctaagacctgtaaccatctttggaccaatagctgatgttgccagagaaaag
ttggcaagagaggagccagatatctatcagattgcaaaaagtgaaccacgagatgctggg
actgaccatcgtagctctggcatcattcgccttcatacaataaagcaaatcatagatcag
gataaacatgctttattagatgtaacgccaaatgcggttgatcgtcttaattatgcgcag
tggtatccaattgttgtgttccttaaccctgactctaagcaaggtgtaaaaacaatgagg
atgaggttgtgtccggagtctcggaaaagcgccaggaagctatatgaacgctctcataag
cttcgtaagaacaatcaccatctcttcacaactacaattaacttaaactcaatgaatgat
ggttggtacggtgccctgaaagaagcgattcagcagcaacagaaccagctggtgtgggtc
tctgaggggaaggcggatggtgctacaagtgatgaccttgatttgcatgacgatcgtctg
tcctacctgtcagccccaggtagtgagtactcaatgtatagcacggacagtagacacact
tctgactatgaagacacagatacagaaggcggggcctacactgatcaagaactagatgaa
actcttaatgatgaggtggggactcccccggagtctgccattacacggtcctctgagcct
gtaagagaggattcctctggaatgcatcatgaaaaccagacataccctccttactcacca
caagcgcagccacaagctattcatagaatagactcccctggacttaagccagcctctcaa
caggtgtacaggaaggagccgtattctgaagaaatgatgagacaaaaccatattttaaaa
caaccagctcttggtcacccagggcagaggccagataaagagccaaatctagcctatgaa
ccccaacttccatatatagaaaaacaagccagcagagaccttgagcagccgtcatacagg
tatgaggtctcaagctacacagaccagttttctcggaactatgaccatcgcctacggttt
gaagatcgaatccctacctatgaagaccagtggtcatattatgatgacaaacagccctac
caacctcggccttttgagaatcagcatccccgagacctggactccagacaacatcccgaa
gaggcttcagaacgaggttatttccagcgttttgaagagccagcccctctgtcgtacgac
agtagaacacgctatgagcagctgcctcgaacctctactctacgacatgaagagcagcca
gcccctgcatatgaggtgcacaacaggtacaggccagaggcacagccctattcttcaaca
ggccctaagtcatctgagcccaagcagtactttgaccagtacccgcgaagttatgagcaa
gttccaccaccaggctttacctccaaaacaggccattacgagcctctccatggtgctgca
gttgtccctcctctgataccttcctctcaacaaaagccagaagtcctgccctcggctacc
aaaccacagcctccacccccaaccctaactgaggaggaggaggatccagcaatgaaacca
cagtctgtgctcaccagagtcaaaatgtttgaaaacaaaagatctgcgtctttggagaac
aagaaagatgtgaatgacactgccagctttaagcctccggaagtagcatctaaacctcca
ggtgcttctcttgctggccctaaacctgtccctcagagtcagtttagtgagcacgacaaa
acgctctacaggctcccagagcctcagaaacctcaagtgaagccacccgaagatattgtt
cgatcaaatcattacgaccctgaagaggatgaagaatattaccggaaacagctctcctac
tttgaccgaagaagttttgagagcaagccttctgcacatcttcctgctggccatcactca
gagcctgctaagccagtccattctcagagccagcccaacttctctagttactcttcaaag
ggaaaacccgaaactgatgctgtggatagatcattcagtgagaaacgttatgatccagcc
caggccacgcctcctcctcctccgttgccctcacagtacagccagccagctccacctctg
tccagctcttctctccacatacattccaagggcgcccagggtgaaggcaactcagtatca
ttggattttcagaactcatatatgtccaaaccagacccacccccatctcagagtaaacca
gcaactttcagaccaccaactcgagaagacccccctcagactttctatccgcagaaaagt
ttcccagacaaagctccagttaacggagctgagcagactcagaaaaccatcactccggtg
tacaatcgattcacaccaaagccgtacacaagttctgcccggccatttgaacgcaaattt
gaaagtccgaagttcaaccataatcttctgccaagtgaaactgtacataaacctgaattg
tcttcaaaaactcccacttccccaaaaactcttatgaaagctcatagttcaacacagcct
ccagagtttgacagtggagttgaaactttctctgttcacacagataagcctaaatatcaa
atgaataatatcagcaccatgcctaaagctgtccctgtgagtccttcagctgtggaagaa
gatgaagatgaggatggtcatactgtagtggctacagctcgtggcatttttaacagcaat
ggtggtgtgttgagttccatagaaaccggtgttagtataattatcccacaaggagccatt
cctgaaggaattgagcaagaaatctatttcaaagtctgcagagacaatagcattctccca
cctttagataaagagaaaggtgaaactctgctgagccccctagtgatgtgtgggccccat
ggcctcaagttcctgaagcccgtggagctacgcttgccacactgtgcgtccatgactcct
gacggttggtcttttgctctaaaatcatccgactcctcgtcgggtgaccctaaaacctgg
caaaacaagtgtcttcctggagatccgaattaccttgttggagccaactgtgtttctgtc
ctgattgaccacttttaa

DBGET integrated database retrieval system