KEGG   Mus musculus (mouse): 218772Help
Entry
218772            CDS       T01002                                 

Gene name
Rarb, A830025K23, Hap, Nr1b2
Definition
retinoic acid receptor, beta
Orthology
K08528  
retinoic acid receptor beta
Organism
mmu  Mus musculus (mouse)
Pathway
Pathways in cancer
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    218772 (Rarb)
   05222 Small cell lung cancer
    218772 (Rarb)
   05223 Non-small cell lung cancer
    218772 (Rarb)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    218772 (Rarb)
Nuclear receptors [BR:mmu03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   218772 (Rarb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
14 A1-A3; 14 7.08 cM
AA seq 482 aa AA seqDB search
MSTSSHACPVPAVRGHMTHYPAAPYPLLFPPVIRGLSLPPLHGLHGHPPPSGCSTPSPAS
VGQACQRTTGGSQFAASTKWTPSLNAAIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQD
KSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGM
SKESVRNDRNKKKKEPSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSS
ADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRI
CTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAIC
LICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAE
RVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNIAEHSPSVSPSSVENSGVSQSPL
LQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccagcagccacgcatgcccagtcccggcagtgcgtggacacatgactcactac
ccagctgcaccctacccattactgttcccccctgtcatcagaggactctccctgcctcca
ctccatgggctccatggccacccacctcccagtggatgcagcaccccatcaccagccagt
gtggggcaggcatgtcagaggacaactggtggaagtcagtttgcagcttctaccaagtgg
acaccaagcttgaatgcagccatcgagacacagagtaccagctctgaggagctcgtcccg
agcccaccatctccacttcctcctcctcgggtgtacaagccctgcttcgtttgccaggac
aagtcatcgggctaccactatggcgtcagtgcctgcgaggggtgcaagggctttttccgc
agaagtattcagaagaacatgatctacacttgccatcgagataagaactgcgtcattaac
aaggtcactaggaaccgatgccagtactgccgcctgcagaagtgctttgaagtgggcatg
tccaaagagtctgttaggaatgacaggaacaagaaaaagaaggagccttcaaagcaggaa
tgcacagagagctatgagatgacagcggagctagacgacctcactgagaagatccggaaa
gcccaccaggaaacctttccctcactctgccagctgggtaaatacaccacgaattccagc
gctgaccaccgggtccgattggacttgggcctctgggacaaattcagtgagctggccacc
aagtgcattattaagatcgtggagttcgccaagcgtctgccgggcttcacaggtctgacc
atcgcagaccagatcaccctgctcaaagccgcctgcttggatatcttgattctcagaatt
tgtaccaggtataccccagagcaagacaccatgactttctctgatggccttacactaaat
cgaactcagatgcacaatgctggcttcggtcctctgactgaccttgtgttcacctttgcc
aaccagctcctgcctttggaaatggatgacacagaaacaggccttctcagtgccatctgt
ttaatctgtggagaccgccaggaccttgaggaaccaacaaaagtagacaagctccaagaa
ccactgctggaagcactaaagatttacattagaaaacgacgacccagcaagcctcacatg
tttccaaagatcttaatgaaaatcacagatctccgcagcatcagcgcgaaaggtgccgaa
cgtgtaattaccttgaaaatggaaattcctggatcaatgccacctctcattcaggaaatg
ctggagaattctgaaggacatgaacccttgaccccaagttcaagtgggaatatagcagag
cacagtcccagcgtgtcccccagctcagtggagaacagtggagtcagtcagtcaccactg
ctgcagtga

DBGET integrated database retrieval system