KEGG   Mus musculus (mouse): 21894Help
Entry
21894             CDS       T01002                                 

Gene name
Tln1, Tln
Definition
(RefSeq) talin 1
  KO
K06271  
talin
Organism
mmu  Mus musculus (mouse)
Pathway
Rap1 signaling pathway
Focal adhesion
Platelet activation
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    21894 (Tln1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    21894 (Tln1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    21894 (Tln1)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    21894 (Tln1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   21894 (Tln1)
  Exosomal proteins of other cancer cells
   21894 (Tln1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4; 4 A5
AA seq 2541 aa AA seqDB search
MVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGLFLSDDDPKKGI
WLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIG
ITNHDEYSLVRELMEEKKDEGTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
FQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQM
HRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFETLPPLGQDAASKAWRKNKMDESK
HEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLED
EGGNGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGESDT
DPHFQDVLMQLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQCALSTSQLVACT
KVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAAATAVTQALNE
LLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAI
KADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMA
TNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASAPKASAGPQPLLVQSCKAVA
EQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQL
SQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLEKDLQEIKAAARDGKLKPLP
GETMEKCTQDLGNSTKAVSSAIAKLLGEIAQGNENYAGIAARDVAGGLRSLAQAARGVAA
LTSDPAVQAIVLDTASDVLDKASSLIEEAKKASGHPGDPESQQRLAQVAKAVTQALNRCV
SCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGLNQAATELVQAS
RGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVSNLKGISMSSSKLLLAAK
ALSTDPASPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRQLETVRELLENP
VQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGDAIATASKALCGFTEAA
AQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQVLSAATIVAK
HTSALCNSCRLASARTANPTAKRQFVQSAKEVANSTANLVKTIKALDGDFTEENRAQCRA
ATAPLLEAVDNLSAFASNPEFSSVPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARAL
AVNPRDPPRWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASL
AAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLASAARAEASQLGHKVSQMAQYFEP
LTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAV
QMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGDPEGSFVDYQTTMVRT
AKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASQAKPAAVAAENEEIGAHIKHRV
QELGHGCSALVTKAGALQCSPSDVYTKKELIECARRVSEKVSHVLAALQAGNRGTQACIT
AASAVSGIIADLDTTIMFATAGTLNREGAETFADHREGILKTAKVLVEDTKVLVQNAAGS
QEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKA
AAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVF
CSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACK
EAAFHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKPNPDLKQQLTGHSKRVAGSV
TELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLN
FEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLISAARMV
AAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAG
NAVKRASDNLVKAAQKAAAFEDQENETVVVKEKMVGGIAQIIAAQEEMLRKERELEEARK
KLAQIRQQQYKFLPSELRDEH
NT seq 7626 nt NT seq  +upstreamnt  +downstreamnt
atggttgcgctttcgctgaagattagcattgggaatgtggtgaagacgatgcaatttgag
ccatctaccatggtgtacgacgcctgccgcatgattcgtgagcggatcccagaggccctg
gctggccctcccaacgactttgggctctttctgtcagatgatgaccccaaaaaaggcatc
tggctagaggctgggaaagctttggactactacatgctccgaaatggggacaccatggag
tacagaaaaaagcagagacccctgaagatccggatgttagacggaacggtgaagactatc
atggtggatgactccaagaccgtcacagacatgctcatgaccatttgtgcccgaattggt
atcaccaaccatgatgagtattcactggttcgagagctgatggaagaaaagaaagatgag
gggacagggaccctgagaaaagacaagaccctactgcgagatgaaaagaagatggagaag
ctaaagcagaagttgcacacagacgatgagttgaactggctggaccatgggcggacactg
agggaacagggagtggaagagcatgagacgttgctgctgcggagaaagttcttctactca
gaccagaatgtggattcccgagaccctgtacagctgaaccttctctatgtgcaggcacga
gatgacatcctgaatggctcccatcctgtctcctttgacaaggcctgtgaatttgcaggc
ttccagtgccagatccagtttggacctcacaatgaacagaagcacaaggctggcttcctt
gacctgaaggacttcctgcccaaggagtatgtgaagcagaagggagagcgtaagatcttt
caggcacacaagaattgtgggcagatgagtgaaattgaggccaaggtacgctacgtgaag
ctggcccgttccctcaagacttacggtgtctccttcttcctagtcaaggaaaagatgaag
gggaagaataaactggtgcccaggctgttgggcatcactaaggagtgtgtgatgcgtgtg
gatgagaagaccaaggaggtgattcaggaatggagcctcaccaacatcaaacgctgggct
gcctctcccaagagctttactctggactttggagactatcaggatggctactactcagta
cagacgacagaaggcgagcagatcgcacagctcattgctggctacatagatatcatcctt
aagaagaaaaaaagcaaggaccattttgggctggagggagatgaagagtctactatgttg
gaggactcagtgtcacccaaaaagtcaacagtccttcagcagcagtacaaccgagtgggg
aaagtggagcacggctctgtggctctgccagccatcatgcgctctggagcctctggtcct
gagaatttccaggtggggagcatgccacctgcccagcagcagatcaccagtggccagatg
caccgaggacacatgccacctctgacttcagcccagcaggcgctcactggaaccattaac
tccagcatgcaggctgtgcaggctgcccaggccactctggatgactttgagactctaccc
cctcttggccaggatgctgcctccaaagcttggcgtaagaacaagatggatgaatcaaag
catgagatccactcccaggtagatgccatcacagctggcactgcctctgtggtaaacctg
acagcaggagatcctgcagagacagactatacagcagtgggctgtgcagtcaccaccatc
tcttccaacctgacggagatgtcccgtggggtgaagctattggctgccctgctggaggat
gaaggcggcaatggccggccccttctgcaagcagcaaagggccttgcaggggctgtgtcg
gaactgcttcgcagtgctcagcccgccagcgctgagccccgtcagaacctgctgcaggca
gccgggaacgtgggccaggccagtggggagctgttgcagcaaattggggaaagtgacact
gacccccacttccaggatgttctaatgcagctagcaaaggcagtggcaagtgctgcagcc
gccctggtcctcaaggccaagagtgtggcccagcgcacagaggattccgggcttcagacc
caagtgattgctgcagctacgcaatgtgctctgtccacttcccagctggtggcctgtacc
aaggtggtagcacctacaatcagctcacctgtgtgccaagaacagctagtcgaggctggg
cgactggtggccaaagctgtggagggctgtgtgtctgcctcgcaagcagctacagaagat
ggacagctgcttcgaggggtaggagcagcagccacggctgtcacccaggccctcaatgag
ctgctgcagcacgtgaaggcccacgccaccggagctgggcctgccggtcggtatgaccaa
gccactgataccatcctcaccgtcactgaaaacatcttcagctccatgggtgatgctggg
gagatggtgcgccaggcccgcatcctggcccaagccacctcagacctggtcaatgctatc
aaggccgatgctgagggggagagtgatctggagaactctagaaagctcctgagtgctgcc
aagatcctcgctgatgccaccgccaagatggtggaggcggccaagggagcagccgcccac
cctgacagtgaggaacagcagcagcgactgcgtgaagcagctgaggggcttcgcatggcc
accaatgcagctgcgcagaacgccatcaagaagaagttggtgcagcgcctggagcatgca
gccaagcaagctgcagcctctgcaacacagaccattgctgcagcccaacatgcagcctct
gcccccaaggcctctgcgggcccccagcccctactggtgcagagctgtaaggccgtggca
gagcagattccgttgctggtgcagggtgtccgaggaagtcaagctcagcctgacagccct
agtgctcagctcgccctcattgctgccagccagagcttcctgcagccaggtgggaagatg
gtggcagcggcaaaagcctcagtgccaacaattcaggaccaggcttcagcaatgcagctg
agtcagtgcgcaaagaacctaggcactgccctggccgagctgcgcactgctgctcagaag
gctcaggaggcatgtggacctttggagatggattctgcactgagtgttgtacaaaatcta
gagaaagacctacaggaaataaaagcagcagctcgagatggcaagcttaagcccttaccc
ggggaaacaatggagaagtgtacccaagatcttggcaacagcaccaaagcggtgagctct
gccatcgccaagctgctgggggagattgcccagggcaatgagaactatgcaggtattgca
gctcgggatgtagctggtggactaaggtcactagcccaggctgcgcggggtgtggctgcg
ctgacatcagatcctgcagtgcaggccattgtgcttgacacagccagcgacgttctggac
aaggccagcagcctcattgaagaggcaaaaaaagcatctggacacccaggggacccagaa
agccagcaaaggcttgctcaggtagctaaagcagtgacccaagccctgaaccgctgtgtc
agctgcctgcctggccaaagagacgtggataatgccctacgagccgttggagatgccagc
aagcgactcctgagtgactcgcttcctccaagcacggggacatttcaagaagcacagagc
cgattgaatgaagctgcagctgggttaaatcaggccgccacagaactggtgcaagcctcc
cgaggaactcctcaggacctggctcgggcctccggccgatttggacaggacttcagcacc
ttcctggaagctggtgtggagatggccggacaggccccgagccaggaggaccgagcccag
gtggtgtccaacctgaagggcatatccatgtcttcaagcaaacttctccttgccgctaag
gccttgtccacagaccctgcttctcccaacctcaagagtcagctggctgcggctgcccgg
gcagtgacggacagcatcaaccagctcatcaccatgtgcacccagcaggcacctggccag
aaggagtgtgacaatgcacttcggcagctagagacagtccgagaactcctggagaatcca
gtccagcccatcaacgacatgtcctacttcggttgcttggacagtgtcatggagaactcc
aaggtcctaggtgaggccatgactggcatctcccaaaatgccaagaatggaaatctgccg
gagtttggagatgccattgccacagcctccaaggctctctgtggcttcacggaggcagcc
gcacaggcagcatatctagttggtgtctctgaccccaacagccaagctggacagcaagga
ctggtggaacccacacagtttgcccgtgcaaaccaggcaattcagatggcctgtcagagt
ctgggggagcctggctgtacccaggcccaggtgttatctgcagccactattgtagccaaa
cacacatctgcattgtgtaacagctgtcgcctggcttccgctaggactgccaatcccact
gccaagcgccagtttgtacagtcagccaaggaggtggccaacagtacagccaatcttgtc
aagaccatcaaggcactagatggggacttcacagaagagaaccgtgcccagtgccgagca
gccacagcccctctgctggaagctgtggataacctgagtgcctttgcctccaaccctgag
ttctccagcgtccctgcccagatcagccctgagggcagagcagccatggagcccattgta
atctctgctaagacaatgttggagagtgctggagggctcatccagacagctcgggcgtta
gcagtcaatccccgagaccccccacgttggtctgtgctagctggccactctcggactgtc
tcagattccatcaagaaacttattacaagcatgagggacaaagccccagggcagctggag
tgtgagacagccattgcggctctgaacagctgcttgcgggacctagatcaggcttcgctt
gccgctgtcagccagcagcttgctccccgtgaaggaatctctcaagaggctttgcacacc
cagatgctcactgcagtgcaagaaatttctcatctcattgagccgctggccagcgctgct
cgggctgaagcctcccagctgggacacaaggtgtcccaaatggcccagtactttgaacca
ctcaccctggctgcagtgggtgctgcgtctaagaccctgagccacccacagcagatggca
cttctggaccagactaaaacgttggcagagtctgccttgcagttgctatatactgccaag
gaggctggtggtaaccccaagcaagcagcacacacccaggaagccctggaggaggctgtg
cagatgatgacagaggccgtagaagacctgacgacgaccctcaacgaagcagccagtgct
gcaggagtcgttggcggcatggtggactctatcactcaggccatcaaccagctagatgaa
ggacctatgggtgacccagaaggctcattcgtagattaccagacaaccatggtgaggaca
gccaaggccattgctgtcactgttcaggagatggtaaccaagtcaaacaccagccctgaa
gagctaggccctcttgccaaccagctgaccagtgactatggccgactggcctcacaagcc
aagcctgcagctgtggctgctgaaaatgaagagataggcgctcacatcaaacaccgagta
caggagctgggccatggctgctctgctctggtcaccaaggcaggtgccttgcagtgtagc
cccagtgatgtctacaccaagaaggagctcatagagtgtgcccgcagagtgtcagagaag
gtctcccatgttctggctgcactccaggctgggaatcgtggtacccaggcctgcattaca
gcagccagtgctgtgtctggtatcattgctgacctcgacaccaccatcatgttcgctact
gctggcacacttaaccgtgagggtgctgaaacttttgctgaccaccgggagggtatctta
aagacagcaaaggttcttgtggaggacaccaaggtcctagtgcagaatgcagctgggagc
caggagaagttggcacaagccgcccagtcctccgtggccaccattacccgcctcgctgat
gtggtcaagctcggtgcagccagcctaggagccgaagaccctgaaactcaggtggtgctg
atcaatgcagtaaaggacgtagccaaggccctgggtgacctcatcagcgctacgaaggct
gcagcgggcaaagttggggatgaccctgcagtgtggcagctcaagaactctgccaaggtg
atggtgaccaatgtgacatcattgctcaagacagtgaaggctgtggaagatgaggccacc
aaaggcacacgggccctagaggcaaccacagagcacatacgtcaggaactggcggtcttc
tgttccccagagccacctgccaagacctctacccctgaagacttcatccgaatgaccaag
ggtattactatggcaacagccaaagccgttgctgctggcaattcctgtcgacaggaagat
gtcattgccacagccaatctgagccgacgggctattgcggacatgcttcgggcttgcaag
gaagcagctttccacccagaagtggcgcctgatgtacggctccgagccctgcactatggc
cgggagtgtgccaatggttacctggaactgctggaccacgtgctgctgacccttcagaag
ccaaacccagacctgaagcagcagctaactggacactcaaagcgggttgctggctctgtg
actgagctcatccaggctgctgaagccatgaaaggaacagagtgggtggacccagaggac
cctactgtcattgctgagaatgaactcttgggagccgcagccgccatcgaggctgcagcc
aagaagctggagcagctgaagcccagggccaaacccaaggaggcggatgagtccttgaac
tttgaggaacaaatcctagaagctgccaagtccatcgctgcagccaccagtgcactggta
aaggctgcgtcagcagcccagagggagctggtggctcaaggaaaggtgggcgccattcca
gccaatgcactggatgatgggcagtggtcgcagggcctcatttccgctgcccgtatggtg
gctgcggccaccaacaatctgtgtgaagcagctaacgcagctgtccagggccatgctagc
caggagaaactcatttcctcagccaagcaagtagctgcctccacagctcagctcctggta
gcttgcaaggtcaaagcagatcaggactctgaggcaatgaaacggctccaggctgctggc
aatgcagtgaagagggcctcagataacctggtaaaggcggcccagaaagctgcagccttc
gaagaccaggagaatgagacggtggtggtgaaggagaaaatggttgggggcattgcccag
attatcgcagcacaggaagagatgcttcggaaggaacgagagctggaagaggctcggaaa
aagctcgcccagatccggcagcagcagtacaagttcttgccttcagagcttcgagacgag
cactaa

DBGET integrated database retrieval system