KEGG   Mus musculus (mouse): 21894Help
Entry
21894             CDS       T01002                                 

Gene name
Tln1, Tln
Definition
(RefSeq) talin 1
  KO
K06271  
talin
Organism
mmu  Mus musculus (mouse)
Pathway
Rap1 signaling pathway
Focal adhesion
Platelet activation
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    21894 (Tln1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    21894 (Tln1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    21894 (Tln1)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    21894 (Tln1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   21894 (Tln1)
  Exosomal proteins of other cancer cells
   21894 (Tln1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4; 4 B1
AA seq 2541 aa AA seqDB search
MVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGLFLSDDDPKKGI
WLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIG
ITNHDEYSLVRELMEEKKDEGTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
FQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQM
HRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFETLPPLGQDAASKAWRKNKMDESK
HEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLED
EGGNGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGESDT
DPHFQDVLMQLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQCALSTSQLVACT
KVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAAATAVTQALNE
LLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAI
KADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMA
TNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASAPKASAGPQPLLVQSCKAVA
EQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQL
SQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLEKDLQEIKAAARDGKLKPLP
GETMEKCTQDLGNSTKAVSSAIAKLLGEIAQGNENYAGIAARDVAGGLRSLAQAARGVAA
LTSDPAVQAIVLDTASDVLDKASSLIEEAKKASGHPGDPESQQRLAQVAKAVTQALNRCV
SCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGLNQAATELVQAS
RGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVSNLKGISMSSSKLLLAAK
ALSTDPASPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRQLETVRELLENP
VQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGDAIATASKALCGFTEAA
AQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQVLSAATIVAK
HTSALCNSCRLASARTANPTAKRQFVQSAKEVANSTANLVKTIKALDGDFTEENRAQCRA
ATAPLLEAVDNLSAFASNPEFSSVPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARAL
AVNPRDPPRWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASL
AAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLASAARAEASQLGHKVSQMAQYFEP
LTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAV
QMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGDPEGSFVDYQTTMVRT
AKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASQAKPAAVAAENEEIGAHIKHRV
QELGHGCSALVTKAGALQCSPSDVYTKKELIECARRVSEKVSHVLAALQAGNRGTQACIT
AASAVSGIIADLDTTIMFATAGTLNREGAETFADHREGILKTAKVLVEDTKVLVQNAAGS
QEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKA
AAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVF
CSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACK
EAAFHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKPNPDLKQQLTGHSKRVAGSV
TELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLN
FEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLISAARMV
AAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAG
NAVKRASDNLVKAAQKAAAFEDQENETVVVKEKMVGGIAQIIAAQEEMLRKERELEEARK
KLAQIRQQQYKFLPSELRDEH
NT seq 7626 nt NT seq  +upstreamnt  +downstreamnt
atggttgcgctttcgctgaagattagcattgggaatgtggtgaagacgatgcaatttgag
ccatctaccatggtgtacgacgcctgccgcatgattcgtgagcggatcccagaggccctg
gctggccctcccaacgactttgggctctttctgtcagatgatgaccccaaaaaaggcatc
tggctagaggctgggaaagctttggactactacatgctccgaaatggggacaccatggag
tacagaaaaaagcagagacccctgaagatccggatgttagacggaacggtgaagactatc
atggtggatgactccaagaccgtcacagacatgctcatgaccatttgtgcccgaattggt
atcaccaaccatgatgagtattcactggttcgagagctgatggaagaaaagaaagatgag
gggacagggaccctgagaaaagacaagaccctactgcgagatgaaaagaagatggagaag
ctaaagcagaagttgcacacagacgatgagttgaactggctggaccatgggcggacactg
agggaacagggagtggaagagcatgagacgttgctgctgcggagaaagttcttctactca
gaccagaatgtggattcccgagaccctgtacagctgaaccttctctatgtgcaggcacga
gatgacatcctgaatggctcccatcctgtctcctttgacaaggcctgtgaatttgcaggc
ttccagtgccagatccagtttggacctcacaatgaacagaagcacaaggctggcttcctt
gacctgaaggacttcctgcccaaggagtatgtgaagcagaagggagagcgtaagatcttt
caggcacacaagaattgtgggcagatgagtgaaattgaggccaaggtacgctacgtgaag
ctggcccgttccctcaagacttacggtgtctccttcttcctagtcaaggaaaagatgaag
gggaagaataaactggtgcccaggctgttgggcatcactaaggagtgtgtgatgcgtgtg
gatgagaagaccaaggaggtgattcaggaatggagcctcaccaacatcaaacgctgggct
gcctctcccaagagctttactctggactttggagactatcaggatggctactactcagta
cagacgacagaaggcgagcagatcgcacagctcattgctggctacatagatatcatcctt
aagaagaaaaaaagcaaggaccattttgggctggagggagatgaagagtctactatgttg
gaggactcagtgtcacccaaaaagtcaacagtccttcagcagcagtacaaccgagtgggg
aaagtggagcacggctctgtggctctgccagccatcatgcgctctggagcctctggtcct
gagaatttccaggtggggagcatgccacctgcccagcagcagatcaccagtggccagatg
caccgaggacacatgccacctctgacttcagcccagcaggcgctcactggaaccattaac
tccagcatgcaggctgtgcaggctgcccaggccactctggatgactttgagactctaccc
cctcttggccaggatgctgcctccaaagcttggcgtaagaacaagatggatgaatcaaag
catgagatccactcccaggtagatgccatcacagctggcactgcctctgtggtaaacctg
acagcaggagatcctgcagagacagactatacagcagtgggctgtgcagtcaccaccatc
tcttccaacctgacggagatgtcccgtggggtgaagctattggctgccctgctggaggat
gaaggcggcaatggccggccccttctgcaagcagcaaagggccttgcaggggctgtgtcg
gaactgcttcgcagtgctcagcccgccagcgctgagccccgtcagaacctgctgcaggca
gccgggaacgtgggccaggccagtggggagctgttgcagcaaattggggaaagtgacact
gacccccacttccaggatgttctaatgcagctagcaaaggcagtggcaagtgctgcagcc
gccctggtcctcaaggccaagagtgtggcccagcgcacagaggattccgggcttcagacc
caagtgattgctgcagctacgcaatgtgctctgtccacttcccagctggtggcctgtacc
aaggtggtagcacctacaatcagctcacctgtgtgccaagaacagctagtcgaggctggg
cgactggtggccaaagctgtggagggctgtgtgtctgcctcgcaagcagctacagaagat
ggacagctgcttcgaggggtaggagcagcagccacggctgtcacccaggccctcaatgag
ctgctgcagcacgtgaaggcccacgccaccggagctgggcctgccggtcggtatgaccaa
gccactgataccatcctcaccgtcactgaaaacatcttcagctccatgggtgatgctggg
gagatggtgcgccaggcccgcatcctggcccaagccacctcagacctggtcaatgctatc
aaggccgatgctgagggggagagtgatctggagaactctagaaagctcctgagtgctgcc
aagatcctcgctgatgccaccgccaagatggtggaggcggccaagggagcagccgcccac
cctgacagtgaggaacagcagcagcgactgcgtgaagcagctgaggggcttcgcatggcc
accaatgcagctgcgcagaacgccatcaagaagaagttggtgcagcgcctggagcatgca
gccaagcaagctgcagcctctgcaacacagaccattgctgcagcccaacatgcagcctct
gcccccaaggcctctgcgggcccccagcccctactggtgcagagctgtaaggccgtggca
gagcagattccgttgctggtgcagggtgtccgaggaagtcaagctcagcctgacagccct
agtgctcagctcgccctcattgctgccagccagagcttcctgcagccaggtgggaagatg
gtggcagcggcaaaagcctcagtgccaacaattcaggaccaggcttcagcaatgcagctg
agtcagtgcgcaaagaacctaggcactgccctggccgagctgcgcactgctgctcagaag
gctcaggaggcatgtggacctttggagatggattctgcactgagtgttgtacaaaatcta
gagaaagacctacaggaaataaaagcagcagctcgagatggcaagcttaagcccttaccc
ggggaaacaatggagaagtgtacccaagatcttggcaacagcaccaaagcggtgagctct
gccatcgccaagctgctgggggagattgcccagggcaatgagaactatgcaggtattgca
gctcgggatgtagctggtggactaaggtcactagcccaggctgcgcggggtgtggctgcg
ctgacatcagatcctgcagtgcaggccattgtgcttgacacagccagcgacgttctggac
aaggccagcagcctcattgaagaggcaaaaaaagcatctggacacccaggggacccagaa
agccagcaaaggcttgctcaggtagctaaagcagtgacccaagccctgaaccgctgtgtc
agctgcctgcctggccaaagagacgtggataatgccctacgagccgttggagatgccagc
aagcgactcctgagtgactcgcttcctccaagcacggggacatttcaagaagcacagagc
cgattgaatgaagctgcagctgggttaaatcaggccgccacagaactggtgcaagcctcc
cgaggaactcctcaggacctggctcgggcctccggccgatttggacaggacttcagcacc
ttcctggaagctggtgtggagatggccggacaggccccgagccaggaggaccgagcccag
gtggtgtccaacctgaagggcatatccatgtcttcaagcaaacttctccttgccgctaag
gccttgtccacagaccctgcttctcccaacctcaagagtcagctggctgcggctgcccgg
gcagtgacggacagcatcaaccagctcatcaccatgtgcacccagcaggcacctggccag
aaggagtgtgacaatgcacttcggcagctagagacagtccgagaactcctggagaatcca
gtccagcccatcaacgacatgtcctacttcggttgcttggacagtgtcatggagaactcc
aaggtcctaggtgaggccatgactggcatctcccaaaatgccaagaatggaaatctgccg
gagtttggagatgccattgccacagcctccaaggctctctgtggcttcacggaggcagcc
gcacaggcagcatatctagttggtgtctctgaccccaacagccaagctggacagcaagga
ctggtggaacccacacagtttgcccgtgcaaaccaggcaattcagatggcctgtcagagt
ctgggggagcctggctgtacccaggcccaggtgttatctgcagccactattgtagccaaa
cacacatctgcattgtgtaacagctgtcgcctggcttccgctaggactgccaatcccact
gccaagcgccagtttgtacagtcagccaaggaggtggccaacagtacagccaatcttgtc
aagaccatcaaggcactagatggggacttcacagaagagaaccgtgcccagtgccgagca
gccacagcccctctgctggaagctgtggataacctgagtgcctttgcctccaaccctgag
ttctccagcgtccctgcccagatcagccctgagggcagagcagccatggagcccattgta
atctctgctaagacaatgttggagagtgctggagggctcatccagacagctcgggcgtta
gcagtcaatccccgagaccccccacgttggtctgtgctagctggccactctcggactgtc
tcagattccatcaagaaacttattacaagcatgagggacaaagccccagggcagctggag
tgtgagacagccattgcggctctgaacagctgcttgcgggacctagatcaggcttcgctt
gccgctgtcagccagcagcttgctccccgtgaaggaatctctcaagaggctttgcacacc
cagatgctcactgcagtgcaagaaatttctcatctcattgagccgctggccagcgctgct
cgggctgaagcctcccagctgggacacaaggtgtcccaaatggcccagtactttgaacca
ctcaccctggctgcagtgggtgctgcgtctaagaccctgagccacccacagcagatggca
cttctggaccagactaaaacgttggcagagtctgccttgcagttgctatatactgccaag
gaggctggtggtaaccccaagcaagcagcacacacccaggaagccctggaggaggctgtg
cagatgatgacagaggccgtagaagacctgacgacgaccctcaacgaagcagccagtgct
gcaggagtcgttggcggcatggtggactctatcactcaggccatcaaccagctagatgaa
ggacctatgggtgacccagaaggctcattcgtagattaccagacaaccatggtgaggaca
gccaaggccattgctgtcactgttcaggagatggtaaccaagtcaaacaccagccctgaa
gagctaggccctcttgccaaccagctgaccagtgactatggccgactggcctcacaagcc
aagcctgcagctgtggctgctgaaaatgaagagataggcgctcacatcaaacaccgagta
caggagctgggccatggctgctctgctctggtcaccaaggcaggtgccttgcagtgtagc
cccagtgatgtctacaccaagaaggagctcatagagtgtgcccgcagagtgtcagagaag
gtctcccatgttctggctgcactccaggctgggaatcgtggtacccaggcctgcattaca
gcagccagtgctgtgtctggtatcattgctgacctcgacaccaccatcatgttcgctact
gctggcacacttaaccgtgagggtgctgaaacttttgctgaccaccgggagggtatctta
aagacagcaaaggttcttgtggaggacaccaaggtcctagtgcagaatgcagctgggagc
caggagaagttggcacaagccgcccagtcctccgtggccaccattacccgcctcgctgat
gtggtcaagctcggtgcagccagcctaggagccgaagaccctgaaactcaggtggtgctg
atcaatgcagtaaaggacgtagccaaggccctgggtgacctcatcagcgctacgaaggct
gcagcgggcaaagttggggatgaccctgcagtgtggcagctcaagaactctgccaaggtg
atggtgaccaatgtgacatcattgctcaagacagtgaaggctgtggaagatgaggccacc
aaaggcacacgggccctagaggcaaccacagagcacatacgtcaggaactggcggtcttc
tgttccccagagccacctgccaagacctctacccctgaagacttcatccgaatgaccaag
ggtattactatggcaacagccaaagccgttgctgctggcaattcctgtcgacaggaagat
gtcattgccacagccaatctgagccgacgggctattgcggacatgcttcgggcttgcaag
gaagcagctttccacccagaagtggcgcctgatgtacggctccgagccctgcactatggc
cgggagtgtgccaatggttacctggaactgctggaccacgtgctgctgacccttcagaag
ccaaacccagacctgaagcagcagctaactggacactcaaagcgggttgctggctctgtg
actgagctcatccaggctgctgaagccatgaaaggaacagagtgggtggacccagaggac
cctactgtcattgctgagaatgaactcttgggagccgcagccgccatcgaggctgcagcc
aagaagctggagcagctgaagcccagggccaaacccaaggaggcggatgagtccttgaac
tttgaggaacaaatcctagaagctgccaagtccatcgctgcagccaccagtgcactggta
aaggctgcgtcagcagcccagagggagctggtggctcaaggaaaggtgggcgccattcca
gccaatgcactggatgatgggcagtggtcgcagggcctcatttccgctgcccgtatggtg
gctgcggccaccaacaatctgtgtgaagcagctaacgcagctgtccagggccatgctagc
caggagaaactcatttcctcagccaagcaagtagctgcctccacagctcagctcctggta
gcttgcaaggtcaaagcagatcaggactctgaggcaatgaaacggctccaggctgctggc
aatgcagtgaagagggcctcagataacctggtaaaggcggcccagaaagctgcagccttc
gaagaccaggagaatgagacggtggtggtgaaggagaaaatggttgggggcattgcccag
attatcgcagcacaggaagagatgcttcggaaggaacgagagctggaagaggctcggaaa
aagctcgcccagatccggcagcagcagtacaagttcttgccttcagagcttcgagacgag
cactaa

DBGET integrated database retrieval system