KEGG   Mus musculus (mouse): 218952Help
Entry
218952            CDS       T01002                                 

Gene name
Fermt2, AA960555, Kindlin-2, Mig2, Plekhc1
Definition
(RefSeq) fermitin family member 2
  KO
K17083  
kindlin 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14; 14 C1
AA seq 680 aa AA seqDB search
MALDGIRMPDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSD
HALWWEKKRTWLLKTHWTLDKCGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVF
KAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLDDQSEDEALELEGPLIMPGSGSIYS
SPGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPVTSPEILAKMFKPQ
ALLDKAKTNQGWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKW
ALLLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAALSDLEITLEGG
KTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSREESSGTPAHQ
LNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTM
ADSSYNLEVQNILSFLKMQHLNPDPQLIPDQITTDVNPECLVSPRYLKKYKSKQITARIL
EAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKREELIGIAYNRLIRMDAST
GDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRA
KDQNESLDEEMFYKLTSGWV
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggctctggacgggataaggatgccagatggctgctacgcggacgggacgtgggaactg
agcgtccatgtcacggacctgaaccgtgatgtcactctgagagtgaccggggaggtgcac
atcggaggggtgatgctgaagttggtggaaaaactcgatgtcaaaaaagattggtcggac
catgctctctggtgggaaaagaagaggacttggctgcttaagacacactggaccttggat
aagtgtggcatccaggcagatgccaagctccagttcaccccgcagcacaaactgctccgc
ctgcagcttcccaacatgaagtatgtgaaggtgaaagtgaacttctctgaccgagtcttc
aaggctgtgtctgacatctgcaagactttcaatataagacaccctgaagaactttctctc
ttaaaaaaacccagagatcccacaaagaaaaaaaagaaaaagctagatgaccagtctgaa
gacgaagcgcttgagctggaaggacctcttatcatgcctggatcaggaagcatatattca
agcccgggactttatagtaaaacaatgacccctacttacgacgctcatgatggaagccct
ttgtcaccaacttctgcctggtttggtgacagtgccctgtcagaaggcaatcctgggata
cttgctgtcagtcagccagtaacatcaccagaaatactggcaaaaatgttcaagcctcaa
gctcttcttgataaagcaaaaaccaaccaagggtggctagattcctcaagatctctcatg
gagcaagatgtgaaggagaacgaggccttgctgctccgattcaagtactacagctttttt
gatttgaatccaaagtatgatgccatcagaatcaatcagctttacgagcaggccaagtgg
gctcttctcctagaagagatcgaatgcacggaagaagagatgatgatgttcgcagccttg
cagtatcatatcaataagctgtcaatcatgacatcagaaaatcatttaaacaacagtgac
aaagaagttgatgaagttgacgctgccctttctgacctggagatcactttggaaggcggg
aaaacatcaacaattctgggtgacattacttcaatcccagaacttgctgactatattaaa
gttttcaagccgaagaagctgactttaaaggggtacaagcagtactggtgcactttcaaa
gacacgtccatctcctgctacaagagccgagaagagtccagtggtacacctgctcatcag
ctgaacctcagaggatgtgaagttactccggatgtaaacatttcaggccagaaatttaac
ataaaactcctaattccggtagcagagggcatgaatgagatctggcttcgctgtgataac
gagaagcagtacgcgcactggatggcagcttgcaggttagcctccaaaggcaagaccatg
gcagacagttcttacaacctggaagttcagaacattctttccttcctgaaaatgcagcat
ctgaacccagacccccagctgatccctgaccagatcacaaccgacgtcaaccccgagtgt
ctggtgtccccgcggtacctgaagaagtataagagcaaacagataacagcacggatcttg
gaggcccatcaaaatgtagcccagatgagcctgattgaagccaagatgagattcattcaa
gcctggcagtctctgcctgagttcggcatcacacacttcattgcgaggtttcaaggcggc
aagagagaagaacttattggaattgcatacaacaggttgattcggatggacgccagcaca
ggtgacgccatcaaaacctggcggttcagcaacatgaagcagtggaatgtcaactgggag
atcaagatggtcactgtagagtttgcagatgaggtccggttgtccttcatctgtaccgaa
gtagactgcaaggtggtccacgaattcattggtggttacatatttctctcaactcgtgcg
aaagaccaaaatgaaagtttagatgaggagatgttctacaaactcaccagtggttgggtg
tga

DBGET integrated database retrieval system