KEGG   Mus musculus (mouse): 21898Help
Entry
21898             CDS       T01002                                 

Gene name
Tlr4, Lps, Ly87, Ran/M1, Rasl2-8
Definition
(RefSeq) toll-like receptor 4
  KO
K10160  
toll-like receptor 4
Organism
mmu  Mus musculus (mouse)
Pathway
NF-kappa B signaling pathway
HIF-1 signaling pathway
Phagosome
PI3K-Akt signaling pathway
Toll-like receptor signaling pathway
Salmonella infection
Pertussis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Malaria
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis B
Measles
Influenza A
Proteoglycans in cancer
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Module
Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    21898 (Tlr4)
   04066 HIF-1 signaling pathway
    21898 (Tlr4)
   04151 PI3K-Akt signaling pathway
    21898 (Tlr4)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    21898 (Tlr4)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    21898 (Tlr4)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    21898 (Tlr4)
  Immune diseases
   05323 Rheumatoid arthritis
    21898 (Tlr4)
   05321 Inflammatiory bowel disease (IBD)
    21898 (Tlr4)
  Infectious diseases
   05132 Salmonella infection
    21898 (Tlr4)
   05133 Pertussis
    21898 (Tlr4)
   05134 Legionellosis
    21898 (Tlr4)
   05152 Tuberculosis
    21898 (Tlr4)
   05162 Measles
    21898 (Tlr4)
   05164 Influenza A
    21898 (Tlr4)
   05161 Hepatitis B
    21898 (Tlr4)
   05146 Amoebiasis
    21898 (Tlr4)
   05144 Malaria
    21898 (Tlr4)
   05145 Toxoplasmosis
    21898 (Tlr4)
   05140 Leishmaniasis
    21898 (Tlr4)
   05142 Chagas disease (American trypanosomiasis)
    21898 (Tlr4)
Cellular antigens [BR:mmu04090]
 Proteins
  21898 (Tlr4)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Hyaluronan
  Cell surface receptors
   21898 (Tlr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4 C1; 4 34.66 cM
AA seq 835 aa AA seqDB search
MMPPWLLARTLIMALFFSCLTPGSLNPCIEVVPNITYQCMDQKLSKVPDDIPSSTKNIDL
SFNPLKILKSYSFSNFSELQWLDLSRCEIETIEDKAWHGLHHLSNLILTGNPIQSFSPGS
FSGLTSLENLVAVETKLASLESFPIGQLITLKKLNVAHNFIHSCKLPAYFSNLTNLVHVD
LSYNYIQTITVNDLQFLRENPQVNLSLDMSLNPIDFIQDQAFQGIKLHELTLRGNFNSSN
IMKTCLQNLAGLHVHRLILGEFKDERNLEIFEPSIMEGLCDVTIDEFRLTYTNDFSDDIV
KFHCLANVSAMSLAGVSIKYLEDVPKHFKWQSLSIIRCQLKQFPTLDLPFLKSLTLTMNK
GSISFKKVALPSLSYLDLSRNALSFSGCCSYSDLGTNSLRHLDLSFNGAIIMSANFMGLE
ELQHLDFQHSTLKRVTEFSAFLSLEKLLYLDISYTNTKIDFDGIFLGLTSLNTLKMAGNS
FKDNTLSNVFANTTNLTFLDLSKCQLEQISWGVFDTLHRLQLLNMSHNNLLFLDSSHYNQ
LYSLSTLDCSFNRIETSKGILQHFPKSLAFFNLTNNSVACICEHQKFLQWVKEQKQFLVN
VEQMTCATPVEMNTSLVLDFNNSTCYMYKTIISVSVVSVIVVSTVAFLIYHFYFHLILIA
GCKKYSRGESIYDAFVIYSSQNEDWVRNELVKNLEEGVPRFHLCLHYRDFIPGVAIAANI
IQEGFHKSRKVIVVVSRHFIQSRWCIFEYEIAQTWQFLSSRSGIIFIVLEKVEKSLLRQQ
VELYRLLSRNTYLEWEDNPLGRHIFWRRLKNALLDGKASNPEQTAEEEQETATWT
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctccctggctcctggctaggactctgatcatggcactgttcttctcctgcctg
acaccaggaagcttgaatccctgcatagaggtagttcctaatattacctaccaatgcatg
gatcagaaactcagcaaagtccctgatgacattccttcttcaaccaagaacatagatctg
agcttcaaccccttgaagatcttaaaaagctatagcttctccaatttttcagaacttcag
tggctggatttatccaggtgtgaaattgaaacaattgaagacaaggcatggcatggctta
caccacctctcaaacttgatactgacaggaaaccctatccagagtttttccccaggaagt
ttctctggactaacaagtttagagaatctggtggctgtggagacaaaattggcctctcta
gaaagcttccctattggacagcttataaccttaaagaaactcaatgtggctcacaatttt
atacattcctgtaagttacctgcatatttttccaatctgacgaacctagtacatgtggat
ctttcttataactatattcaaactattactgtcaacgacttacagtttctacgtgaaaat
ccacaagtcaatctctctttagacatgtctttgaacccaattgacttcattcaagaccaa
gcctttcagggaattaagctccatgaactgactctaagaggtaattttaatagctcaaat
ataatgaaaacttgccttcaaaacctggctggtttacacgtccatcggttgatcttggga
gaatttaaagatgaaaggaatctggaaatttttgaaccctctatcatggaaggactatgt
gatgtgaccattgatgagttcaggttaacatatacaaatgatttttcagatgatattgtt
aagttccattgcttggcgaatgtttctgcaatgtctctggcaggtgtatctataaaatat
ctagaagatgttcctaaacatttcaaatggcaatccttatcaatcattagatgtcaactt
aagcagtttccaactctggatctaccctttcttaaaagtttgactttaactatgaacaaa
gggtctatcagttttaaaaaagtggccctaccaagtctcagctatctagatcttagtaga
aatgcactgagctttagtggttgctgttcttattctgatttgggaacaaacagcctgaga
cacttagacctcagcttcaatggtgccatcattatgagtgccaatttcatgggtctagaa
gagctgcagcacctggattttcagcactctactttaaaaagggtcacagaattctcagcg
ttcttatcccttgaaaagctactttaccttgacatctcttatactaacaccaaaattgac
ttcgatggtatatttcttggcttgaccagtctcaacacattaaaaatggctggcaattct
ttcaaagacaacaccctttcaaatgtctttgcaaacacaacaaacttgacattcctggat
ctttctaaatgtcaattggaacaaatatcttggggggtatttgacaccctccatagactt
caattattaaatatgagtcacaacaatctattgtttttggattcatcccattataaccag
ctgtattccctcagcactcttgattgcagtttcaatcgcatagagacatctaaaggaata
ctgcaacattttccaaagagtctagccttcttcaatcttactaacaattctgttgcttgt
atatgtgaacatcagaaattcctgcagtgggtcaaggaacagaagcagttcttggtgaat
gttgaacaaatgacatgtgcaacacctgtagagatgaatacctccttagtgttggatttt
aataattctacctgttatatgtacaagacaatcatcagtgtgtcagtggtcagtgtgatt
gtggtatccactgtagcatttctgatataccacttctattttcacctgatacttattgct
ggctgtaaaaagtacagcagaggagaaagcatctatgatgcatttgtgatctactcgagt
cagaatgaggactgggtgagaaatgagctggtaaagaatttagaagaaggagtgccccgc
tttcacctctgccttcactacagagactttattcctggtgtagccattgctgccaacatc
atccaggaaggcttccacaagagccggaaggttattgtggtagtgtctagacactttatt
cagagccgttggtgtatctttgaatatgagattgctcaaacatggcagtttctgagcagc
cgctctggcatcatcttcattgtccttgagaaggttgagaagtccctgctgaggcagcag
gtggaattgtatcgccttcttagcagaaacacctacctggaatgggaggacaatcctctg
gggaggcacatcttctggagaagacttaaaaatgccctattggatggaaaagcctcgaat
cctgagcaaacagcagaggaagaacaagaaacggcaacttggacctga

DBGET integrated database retrieval system