KEGG   Mus musculus (mouse): 21926Help
Entry
21926             CDS       T01002                                 

Gene name
Tnf, DIF, TNF-a, TNF-alpha, TNFSF2, TNFalpha, Tnfa, Tnfsf1a, Tnlg1f
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  
tumor necrosis factor superfamily, member 2
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Sphingolipid signaling pathway
mTOR signaling pathway
Apoptosis
TGF-beta signaling pathway
Osteoclast differentiation
Antigen processing and presentation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Hematopoietic cell lineage
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
AGE-RAGE signaling pathway in diabetic complications
Type I diabetes mellitus
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Pertussis
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Malaria
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis C
Hepatitis B
Influenza A
HTLV-I infection
Herpes simplex infection
Proteoglycans in cancer
Asthma
Inflammatory bowel disease (IBD)
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    21926 (Tnf)
   04350 TGF-beta signaling pathway
    21926 (Tnf)
   04064 NF-kappa B signaling pathway
    21926 (Tnf)
   04668 TNF signaling pathway
    21926 (Tnf)
   04071 Sphingolipid signaling pathway
    21926 (Tnf)
   04150 mTOR signaling pathway
    21926 (Tnf)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    21926 (Tnf)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    21926 (Tnf)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    21926 (Tnf)
   04620 Toll-like receptor signaling pathway
    21926 (Tnf)
   04621 NOD-like receptor signaling pathway
    21926 (Tnf)
   04622 RIG-I-like receptor signaling pathway
    21926 (Tnf)
   04650 Natural killer cell mediated cytotoxicity
    21926 (Tnf)
   04612 Antigen processing and presentation
    21926 (Tnf)
   04660 T cell receptor signaling pathway
    21926 (Tnf)
   04664 Fc epsilon RI signaling pathway
    21926 (Tnf)
  Endocrine system
   04920 Adipocytokine signaling pathway
    21926 (Tnf)
  Development
   04380 Osteoclast differentiation
    21926 (Tnf)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    21926 (Tnf)
  Immune diseases
   05310 Asthma
    21926 (Tnf)
   05322 Systemic lupus erythematosus
    21926 (Tnf)
   05323 Rheumatoid arthritis
    21926 (Tnf)
   05321 Inflammatiory bowel disease (IBD)
    21926 (Tnf)
   05330 Allograft rejection
    21926 (Tnf)
   05332 Graft-versus-host disease
    21926 (Tnf)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    21926 (Tnf)
   05014 Amyotrophic lateral sclerosis (ALS)
    21926 (Tnf)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    21926 (Tnf)
   05414 Dilated cardiomyopathy (DCM)
    21926 (Tnf)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    21926 (Tnf)
   04940 Type I diabetes mellitus
    21926 (Tnf)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    21926 (Tnf)
   04931 Insulin resistance
    21926 (Tnf)
   04933 AGE-RAGE signaling pathway in diabetic complications
    21926 (Tnf)
  Infectious diseases
   05133 Pertussis
    21926 (Tnf)
   05134 Legionellosis
    21926 (Tnf)
   05152 Tuberculosis
    21926 (Tnf)
   05166 HTLV-I infection
    21926 (Tnf)
   05164 Influenza A
    21926 (Tnf)
   05161 Hepatitis B
    21926 (Tnf)
   05160 Hepatitis C
    21926 (Tnf)
   05168 Herpes simplex infection
    21926 (Tnf)
   05146 Amoebiasis
    21926 (Tnf)
   05144 Malaria
    21926 (Tnf)
   05145 Toxoplasmosis
    21926 (Tnf)
   05140 Leishmaniasis
    21926 (Tnf)
   05142 Chagas disease (American trypanosomiasis)
    21926 (Tnf)
   05143 African trypanosomiasis
    21926 (Tnf)
Cytokines [BR:mmu04052]
 TNF family
  21926 (Tnf)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Cytokines (General comment) Chemotaxis, singal transduction, inflammation
   21926 (Tnf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17 B1; 17 18.59 cM
AA seq 235 aa AA seqDB search
MSTESMIRDVELAEEALPQKMGGFQNSRRCLCLSLFSFLLVAGATTLFCLLNFGVIGPQR
DEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGM
DLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCP
KDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagaaagcatgatccgcgacgtggaactggcagaagaggcactcccccaaaag
atggggggcttccagaactccaggcggtgcctatgtctcagcctcttctcattcctgctt
gtggcaggggccaccacgctcttctgtctactgaacttcggggtgatcggtccccaaagg
gatgagaagttcccaaatggcctccctctcatcagttctatggcccagaccctcacactc
agatcatcttctcaaaattcgagtgacaagcctgtagcccacgtcgtagcaaaccaccaa
gtggaggagcagctggagtggctgagccagcgcgccaacgccctcctggccaacggcatg
gatctcaaagacaaccaactagtggtgccagccgatgggttgtaccttgtctactcccag
gttctcttcaagggacaaggctgccccgactacgtgctcctcacccacaccgtcagccga
tttgctatctcataccaggagaaagtcaacctcctctctgccgtcaagagcccctgcccc
aaggacacccctgagggggctgagctcaaaccctggtatgagcccatatacctgggagga
gtcttccagctggagaagggggaccaactcagcgctgaggtcaatctgcccaagtactta
gactttgcggagtccgggcaggtctactttggagtcattgctctgtga

DBGET integrated database retrieval system