KEGG   Mus musculus (mouse): 21933Help
Entry
21933             CDS       T01002                                 

Gene name
Tnfrsf10b, DR5, KILLER, Ly98, MK, TRAILR2, TRICK2A, TRICK2B, TRICKB
Definition
(RefSeq) tumor necrosis factor receptor superfamily, member 10b
  KO
K04722  
tumor necrosis factor receptor superfamily member 10
Organism
mmu  Mus musculus (mouse)
Pathway
Cytokine-cytokine receptor interaction
Apoptosis
Natural killer cell mediated cytotoxicity
Measles
Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    21933 (Tnfrsf10b)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    21933 (Tnfrsf10b)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    21933 (Tnfrsf10b)
 Human Diseases
  Infectious diseases
   05162 Measles
    21933 (Tnfrsf10b)
   05164 Influenza A
    21933 (Tnfrsf10b)
Cytokine receptors [BR:mmu04050]
 TNF receptor family
  21933 (Tnfrsf10b)
Cellular antigens [BR:mmu04090]
 Proteins
  21933 (Tnfrsf10b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
14; 14 D2
AA seq 381 aa AA seqDB search
MEPPGPSTPTASAAARADHYTPGLRPLPKRRLLYSFALLLAVLQAVFVPVTANPAHNRPA
GLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETR
CNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWASWHK
LGLWIGLLVPVVLLIGALLVWKTGAWRQWLLCIKRGCERDPESANSVHSSLLDRQTSSTT
NDSNHNTEPGKTQKTGKKLLVPVNGNDSADDLKFIFEYCSDIVPFDSWNRLMRQLGLTDN
QIQMVKAETLVTREALYQMLLKWRHQTGRSASINHLLDALEAVEERDAMEKIEDYAVKSG
RFTYQNAAAQPETGPGGSQCV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggagcctccaggacccagcacgcccacagcctctgccgctgcccgggcagatcactac
accccaggcctccggccactcccgaagcgcagacttctatatagctttgcgttgctgctt
gctgtgctacaggctgtctttgttccagtaacagctaacccagcccataatcgtccagct
ggcctacagcggccggaggagagcccatcaagaggaccctgtctagcaggccagtacctg
tcagaagggaactgcaagccttgcagagagggtattgactacaccagccattccaaccat
tctctggattcatgtattctctgcacagtctgtaaggaagataaagtcgtagaaacccga
tgcaacataaccacaaatacggtgtgtcgatgcaaaccaggcacctttgaagataaagac
tcccctgagatctgccagtcatgctctaactgcactgacggggaagaggaactgacttcc
tgtacccccagagaaaaccggaagtgtgtctccaaaacggcttgggcatcttggcataag
ctaggcctctggataggactcctggttccagtagtgctgctgattggagctctgcttgtc
tggaagactggagcatggaggcaatggttgctctgtataaaaagaggctgtgaacgggat
cccgaaagtgcgaactctgtgcattcgtctctcttggaccgacagacatctagcacgaca
aatgactctaaccacaacacggaacctggcaagactcagaaaacaggaaagaagttgctg
gttccggtaaacggaaacgactcagctgacgacctgaagtttatcttcgagtattgttcg
gacatagtgccctttgactcctggaaccgtctcatgcggcagttgggcctcacagacaat
caaatccaaatggtcaaagccgaaacactggtcacacgtgaggccctgtaccaaatgctg
ctcaagtggcgccaccagactgggcgaagtgcctccatcaaccatctgctggatgccttg
gaagccgtggaagagagagatgccatggagaaaattgaagactacgcagtgaaatccggg
aggtttacttatcagaacgctgcagcccaaccagagacagggccaggaggatctcagtgc
gtttga

DBGET integrated database retrieval system