KEGG   Mus musculus (mouse): 21952Help
Entry
21952             CDS       T01002                                 

Gene name
Tnni1, 2700018B22Rik, AI747285, ssTnI
Definition
(RefSeq) troponin I, skeletal, slow 1
  KO
K10371  
troponin I, slow skeletal muscle
Organism
mmu  Mus musculus (mouse)
Brite
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     21952 (Tnni1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 E4; 1 59.28 cM
AA seq 187 aa AA seqDB search
MPEVERKSKITASRKLMLKSLMLAKAKECWEQEHEEREAEKVRYLSERIPTLQTRGLSLS
ALQDLCRELHAKVEVVDEERYDIEAKCLHNTREIKDLKLKVLDLRGKFKRPPLRRVRVSA
DAMLRALLGSKHKVSMDLRANLKSVKKEDTEKERPVEVGDWRKNVEAMSGMEGRKKMFDA
AKSPTSQ
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagttgagaggaaatccaagatcactgcctcccgtaaactcatgctgaagagc
ctgatgctagccaaggccaaggagtgttgggagcaggaacacgaggagcgagaggctgag
aaggtgcgttacctctcggagcgcattcccacactgcagacccgcggtctgtctctcagt
gcccttcaggacttgtgccgagagctccatgccaaggtagaggtggtggatgaggagcgc
tatgatattgaagccaaatgcctccacaacaccagagagatcaaggacctgaagctgaag
gtgctggacctccgtgggaagttcaagcgtcctcccctgcgccgggtccgtgtctcagcc
gatgccatgctccgagccctactgggctctaagcacaaggtgtccatggatctgcgggcc
aacctcaagtctgtgaagaaagaagacacagaaaaggagcggccagtcgaggtaggagac
tggaggaagaatgtggaggctatgtctggcatggaaggccgcaagaagatgttcgacgct
gctaagtccccgacctcccagtag

DBGET integrated database retrieval system