KEGG   Mus musculus (mouse): 21954Help
Entry
21954             CDS       T01002                                 

Gene name
Tnni3, Tn1, cTnI
Definition
(RefSeq) troponin I, cardiac 3
  KO
K12044  
troponin I, cardiac muscle
Organism
mmu  Mus musculus (mouse)
Pathway
cAMP signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    21954 (Tnni3)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    21954 (Tnni3)
   04261 Adrenergic signaling in cardiomyocytes
    21954 (Tnni3)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    21954 (Tnni3)
   05414 Dilated cardiomyopathy (DCM)
    21954 (Tnni3)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     21954 (Tnni3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 A1; 7 2.61 cM
AA seq 211 aa AA seqDB search
MADESSDAAGEPQPAPAPVRRRSSANYRAYATEPHAKKKSKISASRKLQLKTLMLQIAKQ
EMEREAEERRGEKGRVLRTRCQPLELDGLGFEELQDLCRQLHARVDKVDEERYDVEAKVT
KNITEIADLTQKIYDLRGKFKRPTLRRVRISADAMMQALLGTRAKESLDLRAHLKQVKKE
DIEKENREVGDWRKNIDALSGMEGRKKKFEG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgagagcagcgatgcggctggggaaccgcagcctgcgcctgctcctgtccga
cgccgctcctctgccaactaccgagcctatgccaccgagccacacgccaagaaaaagtct
aagatctccgcctccagaaaacttcagttgaagactctgatgctgcagattgcgaagcag
gagatggaacgagaggcagaagagcgacgtggagagaaggggcgcgttctgaggactcgt
tgccagcctttggagttggatgggctgggctttgaagagcttcaggacttatgccgacag
cttcacgctcgggtggacaaagtggatgaagagagatatgacgtggaagcaaaagtcacc
aagaacatcactgagattgcagatctgacccagaagatctatgacctccgtggcaagttt
aagcggcccaccctccgaagagtgaggatctctgcagatgccatgatgcaggcgctgctg
gggacccgggccaaggaatccttggacctgagggcccacctcaagcaggtgaagaaggag
gacattgagaaggaaaaccgggaggtgggagactggcgcaagaatatcgatgcactgagt
ggcatggaaggccgcaagaaaaagtttgagggctga

DBGET integrated database retrieval system