KEGG   Mus musculus (mouse): 21969Help
Entry
21969             CDS       T01002                                 

Gene name
Top1, AI467334, D130064I21Rik, Top-1
Definition
(RefSeq) topoisomerase (DNA) I (EC:5.99.1.2)
  KO
K03163  
DNA topoisomerase I [EC:5.99.1.2]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.2  DNA topoisomerase
     21969 (Top1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Topoisomerases
   21969 (Top1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 80.96 cM; 2 H2-3
AA seq 767 aa AA seqDB search
MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKDKDKDREKSKHSNSEHKDSE
KKHKEKEKTKHKDGSSEKHKDKHKDRDKERRKEEKIRAAGDAKIKKEKENGFSSPPRIKD
EPEDDGYFAPPKEDIKPLKRLRDEDDADYKPKKIKTEDIKKEKKRKSEEEEDGKLKKPKN
KDKDKKVAEPDNKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPESV
KFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNDEKNTITNLS
KCDFTQMSQYFKAQSEARKQMSKEEKLKIKEENEKLLKEYGFCVMDNHRERIANFKIEPP
GLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTE
NIQGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVA
LYFIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFPGKDSIRYY
NKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITL
QQQLKELTAPDENVPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQSKIDAKKDQL
ADARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGT
SKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMTDEDYEF
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgagcggggaccatctccacaacgattcccagatcgaagcggatttccgattgaatgat
tctcacaaacacaaagataaacacaaagatcgagaacaccggcataaggagcacaagaag
gataaggataaggaccgggaaaagtctaagcatagcaacagtgaacataaagattctgaa
aagaaacacaaagagaaagagaaaaccaaacacaaagatggcagctcagaaaaacataaa
gacaaacataaagacagagacaaggaaagacgaaaggaggaaaagattagagctgctggg
gatgcaaaaataaagaaggaaaaggaaaatggcttctctagtccgccacgaattaaagat
gaacctgaggatgatggctattttgctcctccaaaagaggatattaagccattgaagagg
cttcgagatgaagatgatgctgattataaacctaagaaaattaagacagaagatatcaag
aaggagaagaaaagaaaatcagaagaggaagaggatggtaaacttaaaaagcccaagaat
aaagataaagataaaaaagttgctgagccagataataagaaaaagaagccgaaaaaggaa
gaggaacagaagtggaaatggtgggaagaagaacgttatccagaaggcatcaaatggaaa
ttcctagagcataaagggcctgtcttcgctccaccatatgagcctctgccagagagtgtc
aagttttactatgatggtaaagttatgaagctgagtcctaaagcagaagaagtagctaca
ttctttgcaaaaatgcttgaccacgaatatactactaaggaaatattcaggaaaaatttc
tttaaagattggagaaaggaaatgactaatgacgaaaaaaatacgattaccaacctaagc
aaatgcgactttacacagatgagccagtatttcaaagcgcagtcagaagctcggaaacag
atgagcaaggaagaaaaattgaaaatcaaagaagaaaatgaaaagttattgaaagaatac
ggcttttgtgtaatggataatcatagagagcggattgccaacttcaagatagagcctccg
gggcttttccgaggccgagggaaccaccccaagatgggtatgctgaagagaaggatcatg
cctgaggacatcatcatcaactgtagcaaagacgcaaaggttccttctccccctcctgga
cataaatggaaggaagtccgacatgataacaaggttacttggctggtctcctggacagag
aatatccaaggttctatcaaatatatcatgctgaatcccagttcacgaatcaagggtgag
aaagactggcagaagtatgagactgcgcggcgtctgaagaagtgtgtggacaagatccga
aatcagtatcgggaagactggaagtccaaagagatgaaagttcgtcagagagctgtagca
ctgtacttcattgataagcttgctctgagagcaggcaatgagaaggaagaaggagagacg
gcagacactgtgggctgctgttcacttagagtggaacacatcaatttacacccagaattg
gatggtcaggagtatgtggtggaatttgactttcctgggaaggactcaatcagatactat
aacaaagtcccagttgagaaacgagtttttaaaaacttacaactgtttatggagaacaag
cagcctgaggacgatctttttgatcgacttaatactggtattctaaataaacatcttcag
gatctcatggagggcttgactgccaaggtgttccgtacctacaatgcctccatcacacta
cagcagcagcttaaagagctcacagcccctgatgagaatgtaccagcgaagattctatct
tataaccgtgccaatcgagctgttgcaattctttgtaaccaccagagggcgccaccaaag
acctttgagaagtcaatgatgaacttgcagtctaagattgatgccaagaaagatcagtta
gcagatgctcgaagggacctgaaaagtgctaaggctgatgccaaagtcatgaaggatgca
aagaccaagaaggtagtagagtcaaaaaagaaggctgtacagagactagaagagcagttg
atgaagctggaagttcaagccacagatcgagaggagaacaaacaaattgccttggggacc
tccaaactcaattatctggaccctaggatcacagtggcttggtgcaaaaagtggggggtc
ccaattgagaagatttacaacaaaacccagagggagaagtttgcttgggccattgatatg
actgatgaggactacgagttttga

DBGET integrated database retrieval system