KEGG   Mus musculus (mouse): 21973Help
Entry
21973             CDS       T01002                                 

Gene name
Top2a, Top-2
Definition
(RefSeq) topoisomerase (DNA) II alpha (EC:5.99.1.3)
  KO
K03164  
DNA topoisomerase II [EC:5.99.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
Platinum drug resistance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Antineoplastic resistance
   01524 Platinum drug resistance
    21973 (Top2a)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.3  DNA topoisomerase (ATP-hydrolysing)
     21973 (Top2a)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Topoisomerases
   21973 (Top2a)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Chromosome condensation proteins
   Other regulators of chromosome condensation
    21973 (Top2a)
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    21973 (Top2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 D; 11 62.91 cM
AA seq 1528 aa AA seqDB search
MELSPLQPVNENMLMNKKKNEDGKKRLSIERIYQKKTQLEHILLRPDTYIGSVELVTQQM
WVYDEDVGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNVISIWNN
GKGIPVVEHKVEKIYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVET
ASREYKKMFKQTWMDNMGRAGDMELKPFSGEDYTCITFQPDLSKFKMQSLDKDIVALMVR
RAYDIAGSTKDVKVFLNGNSLPVKGFRSYVDLYLKDKVDETGNSLKVIHEQVNPRWEVCL
TMSERGFQQISFVNSIATSKGGRHVDYVADQIVSKLVDVVKKKNKGGVAVKAHQVKNHMW
IFVNALIENPTFDSQTKENMTLQAKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQI
QLNKKCSAVKHTKIKGIPKLDDANDAGSRNSTECTLILTEGDSAKTLAVSGLGVVGRDKY
GVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTD
QDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEIAFYSLPEFEEWKSS
TPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQVDDR
KEWLTNFMEDRRQRKLLGLPEDYLYGQSTSYLTYNDFINKELILFSNSDNERSIPSMVDG
LKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNL
NLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLARLLFPPKDDHTLRFLYDDNQRVEPEWY
IPIIPMVLINGAEGIGTGWSCKIPNFDVREVVNNIRRLLDGEEPLPMLPSYKNFKGTIEE
LASNQYVINGEVAILDSTTIEISELPIRTWTQTYKEQVLEPMLNGTEKTPSLITDYREYH
TDTTVKFVIKMTEEKLAEAERVGLHKVFKLQSSLTCNSMVLFDHVGCLKKYDTVLDILRD
FFELRLKYYGLRKEWLLGMLGAESSKLNNQARFILEKIDGKIVIENKPKKELIKVLIQRG
YDSDPVKAWKEAQQKVPDEEENEESDTETSTSDSAAEAGPTFNYLLDMPLWYLTKEKKDE
LCKQRNEKEQELNTLKQKSPSDLWKEDLAVFIEELEVVEAKEKQDEQVGLPGKAGKAKGK
KAQMCADVLPSPRGKRVIPQVTVEMKAEAEKKIRKKIKSENVEGTPAEDGAEPGSLRQRI
EKKQKKEPGAKKQTTLPFKPVKKGRKKNPWSDSESDVSSNESNVDVPPRQKEQRSAAAKA
KFTVDLDSDEDFSGLDEKDEDEDFLPLDATPPKAKIPPKNTKKALKTQGSSMSVVDLESD
VKDSVPASPGVPAADFPAETEQSKPSKKTVGVKKTATKSQSSVSTAGTKKRAAPKGTKSD
SALSARVSEKPAPAKAKNSRKRKPSSSDSSDSDFERAISKGATSKKAKGEEQDFPVDLED
TIAPRAKSDRARKPIKYLEESDDDDDLF
NT seq 4587 nt NT seq  +upstreamnt  +downstreamnt
atggagttgtcaccgctgcagcctgtaaatgaaaatatgctaatgaacaaaaagaagaat
gaagatggcaagaaaagattgtctattgaaagaatctatcagaaaaaaacacaactggaa
catatactgctccgcccagatacctacattggctctgtggagttagtgacccagcaaatg
tgggtttacgatgaagatgttggcattaactacagggaagtcacttttgttcctggtttg
tataaaatctttgatgagattctagttaatgctgctgataacaaacaaagggacccaaaa
atgtcttgtattagagtcacaattgatccagaaaataatgtaattagcatctggaataat
gggaaaggaatccctgttgttgaacacaaagttgagaaaatatatgtcccagctctcata
tttggacaactcctgacctccagtaactatgacgacgatgagaagaaagtgacaggtggt
cgaaatggctatggagctaaactgtgtaacatattcagcaccaaatttactgtggaaaca
gccagtagagagtacaagaaaatgttcaaacagacgtggatggataacatggggagagct
ggtgacatggaactcaagccctttagtggagaagattatacatgtatcaccttccagcct
gacttatctaagtttaaaatgcaaagcctggacaaagatattgttgcactgatggtcaga
agagcatatgatatcgctggctccactaaagatgtcaaagtctttcttaatggaaatagt
ctgccagtgaaaggattccgcagttacgtggatttgtatttgaaggataaggtagatgaa
actgggaattcactgaaggtgatacatgaacaggtcaatccccggtgggaagtgtgctta
acaatgagcgagagaggcttccagcagattagcttcgtcaacagcattgcgacttctaag
ggcggcagacatgtcgattatgtagctgatcagattgtgagcaaactcgttgatgtggtg
aaaaagaagaacaagggcggggttgcagtgaaggctcatcaggtgaaaaatcacatgtgg
atttttgtaaatgccttaattgaaaacccaacctttgactctcaaacaaaagaaaacatg
actttacaagccaagagctttggatcaacatgtcaattaagtgaaaagttcatcaaagct
gcaattggttgtggtattgtggaaagcatactaaactgggtgaagttcaaggctcaaatc
caactgaacaagaagtgttcagctgtaaaacataccaaaatcaagggaatccccaaactt
gatgatgccaacgatgcagggagccgaaactctactgaatgcacacttatcctgactgag
ggagactcagcaaaaactctagccgtttcaggccttggagtggttggaagagacaaatat
ggggtgttccctcttagaggaaagatactcaatgtgcgagaagcctctcataaacagatc
atggaaaatgctgaaattaacaatatcatcaagattgtgggtctccagtacaagaaaaac
tatgaagatgaagattcattgaaaactcttcgttatgggaagatcatgattatgacagat
caggaccaagatggttcccacatcaaaggcttgctgatcaattttatccatcacaattgg
ccatctcttctgcgacatcgttttctagaagaatttatcactcccattgtaaaggtgtcc
aaaaataagcaagaaatagcattctatagtcttcccgagtttgaagaatggaaaagttcg
actccgaatcataaaaagtggaaagtcaaatactacaaaggtttgggcaccagcacatca
aaggaagctaaggaatattttgcagatatgaaacgacatcgtattcagttcaaatactct
ggccctgaagatgatgctgcgatcagcctggcctttagtaaaaaacaagttgatgatcga
aaggaatggttaactaattttatggaagacagaagacagcggaagttacttggccttcct
gaggattatttgtatggacaaagcacttcgtacctgacctataatgacttcataaacaag
gaactcatcctcttctccaactctgataatgaaaggtctatcccatccatggtagacggt
ttgaaaccaggtcagagaaaggttttgtttacttgtttcaaacggaatgacaagcgagaa
gtgaaggttgcccagttagctgggtcagtggcagaaatgtcctcttatcaccatggtgag
atgtcactgatgatgaccattatcaatttggcgcagaattttgtgggtagcaataatttg
aaccttttacagcccattggtcagtttggaaccaggctgcatggtggcaaggactcagct
agtcctaggtacatctttacaatgctcagccctttggctcggttgttgtttcctccaaaa
gatgatcacacattacggtttctatatgatgacaaccaacgtgttgagcctgaatggtac
attcctataatacccatggtgctgataaatggtgctgagggaattggtactgggtggtcc
tgcaaaatccccaactttgatgtgcgtgaagttgtgaataatatcagacggcttctggat
ggagaggagcccctacccatgctcccaagttataagaatttcaaaggtactattgaagaa
ctggcttcaaatcagtatgtgattaatggagaagtagctattctggattctacaaccatt
gaaatctcagagcttcccatccgaacgtggactcagacatataaagaacaggttctagaa
cccatgttgaatggaactgagaagacaccctctctaataacagactatagggaataccat
acagataccactgtgaagtttgtcataaagatgactgaagaaaaactggcagaggcagag
agagtcggcctacacaaagtcttcaaactccagagtagtctcacttgcaactctatggtg
ctttttgaccatgtaggttgcttaaagaaatatgacactgtgttggatattctaagagac
ttctttgagctcaggcttaaatattatggattaagaaaagaatggcttctaggaatgctt
ggtgcagaatcttctaaactgaataatcaagctcgctttatattagagaaaatagatggc
aaaatagtcattgaaaataaacctaaaaaagaattaattaaagttctgattcagagaggc
tacgactctgaccctgtgaaagcctggaaagaagctcagcagaaggttccagatgaagaa
gaaaatgaagaaagtgacactgaaaccagcaccagtgactctgcagccgaggctgggccg
accttcaactaccttctcgacatgcccctgtggtatctgaccaaggagaagaaggatgag
ctgtgcaaacaaagaaacgagaaggaacaagagctcaacacattaaagcaaaagagtcca
tcagatctgtggaaggaagatctggctgtttttattgaagaactggaggttgtcgaggcc
aaggaaaagcaggatgaacaagtgggccttcctggaaaggcggggaaagcaaaggggaag
aaagcacagatgtgtgctgacgtcttgccttctcctcggggcaaaagagtcatcccccaa
gtgactgtggagatgaaagctgaggcagagaagaaaattaggaagaaaattaagagtgaa
aacgttgagggtacccctgctgaggatggtgcggaaccaggaagcctccggcaacgaata
gagaagaagcagaagaaagagccaggtgcaaagaagcagactacattgccgtttaagcct
gtcaaaaaagggaggaagaaaaacccctggtctgactctgagtcagacgtgagcagtaat
gaaagtaacgttgatgtccctcctcgacaaaaagagcaaagaagtgctgcagcaaaagcc
aaattcacagtggatttagactcggatgaagatttctcaggtttggatgagaaggatgag
gatgaagatttcctcccattagatgctactccacctaaggccaaaatccccccaaaaaat
actaaaaaagcactgaagacccagggaagctccatgtcggtagttgatcttgaaagtgat
gttaaggacagtgtgccagcttctccaggcgttcctgctgctgacttcccagcggaaact
gaacagtcaaagccatccaaaaagaccgtgggagtgaagaagacagcaaccaaaagccag
tcttcagtctccactgctggtaccaaaaagagagctgcgccaaagggaaccaaatcagat
tcagccttgagtgctcgtgtctcggaaaaacctgctcctgccaaagccaagaacagtcgc
aaaaggaagccatcttcttctgatagctctgactctgattttgagagagcaatttctaaa
ggtgccacgagcaagaaagcaaagggagaggaacaggacttccctgtggacttggaagac
acgatagctcctcgagccaaatctgaccgggcgaggaagccaattaagtacctggaggag
tccgatgacgatgacgacctcttctga

DBGET integrated database retrieval system