KEGG   Mus musculus (mouse): 21974Help
Entry
21974             CDS       T01002                                 

Gene name
Top2b, D230016L12Rik, Top-2
Definition
(RefSeq) topoisomerase (DNA) II beta
  KO
K03164  
DNA topoisomerase II [EC:5.99.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
Platinum drug resistance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Drug resistance
   01524 Platinum drug resistance
    21974 (Top2b)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.3  DNA topoisomerase (ATP-hydrolysing)
     21974 (Top2b)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Topoisomerases
   21974 (Top2b)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Chromosome condensation proteins
   Other regulators of chromosome condensation
    21974 (Top2b)
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    21974 (Top2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
14; 14 A2
AA seq 1612 aa AA seqDB search
MAKSSLAGSDGALTWVNNATKKEELETANKNDSTKKLSVERVYQKKTQLEHILLRPDTYI
GSVEPLTQLMWVYDEDVGMNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDP
ESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCN
IFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKL
DKDIVALMTRRAYDLAGSCKGVKVMFNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHE
LANERWDVCLTLSEKGFQQISFVNSIATTKGGRHVDYVVDQVVSKLIEVVKKKNKAGVSV
KPFQVKNHIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFFKAASNCGIVESI
LNWVKFKAQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVS
GLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTL
RYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKASKNKQELSFYS
IPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITL
AFSKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDN
ERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNL
AQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSSLARLLFPAVDDNLLKFLYD
DNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLEGLDPHPMLPN
YKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTP
ALISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKK
YETVQDILKEFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKK
DLIQMLVQRGYESDPVKAWKEAQEKAAEEEDSQNQHDDSSSDSGTPSGPDFNYILNMSLW
SLTKEKVEELIKQRDTKGREVNDLKRKSPSDLWKEDLAAFVEELDKVEAQEREDILAGMS
GKAIKGKVGKPKVKKLQLEETMPSPYGRRIVPEITAMKADASRKLLKKKKGDPDTTVVKV
EFDEEFSGTPAEGTGEETLTPSAPVNKGPKPKREKKEPGTRVRKTPTSTGKTNAKKVKKR
NPWSDDESKSESDLEEAEPVVIPRDSLLRRAAAERPKYTFDFSEEEDDDAAAADDSNDLE
ELKVKASPITNDGEDEFVPSDGLDKDEYAFSSGKSKATPEKSSNDKKSQDFGNLFSFPSY
SQKSEDDSAKFDSNEEDTASVFAPSFGLKQTDKLPSKTVAAKKGKPPSDTAPKAKRAPKQ
KKIVETINSDSDSEFGIPKKTTTPKGKGRGAKKRKASGSENEGDYNPGRKPSKTASKKPK
KTSFDQDSDVDIFPSDFTSEPPALPRTGRARKEVKYFAESDEEEDVDFAMFN
NT seq 4839 nt NT seq  +upstreamnt  +downstreamnt
atggccaagtccagcctcgcgggctctgacggggcgctgacctgggtgaacaatgctaca
aaaaaggaagagttggagacagcaaacaaaaatgactctactaagaagttgtctgttgag
agagtgtaccagaagaagacccaactggagcacattctccttcgtcctgatacatacatt
ggatcagtggagccactgacacagctaatgtgggtgtatgatgaagatgtagggatgaac
tgcagggaggtcacctttgttccaggcttatacaagatctttgatgaaattttggttaat
gctgctgacaacaagcagagggacaagaacatgacctgtattaaggtttctattgatcct
gaatctaatattataagcatttggaataatgggaaaggcattccagtagtagaacacaaa
gtagagaaagtttatgttcctgctttaatttttggacagcttttaacatcgagtaattat
gacgatgatgagaaaaaagttacaggaggccgtaatggttatggtgcaaagctttgtaat
atttttagtacaaagtttacagtagaaacggcttgcaaagaatacaaacatagttttaaa
cagacatggatgaataatatgatgaagacttctgaagccaaaattaaacattttgatggt
gaagattatacatgcataacattccagccagatctatccaaatttaagatggaaaaactt
gacaaggacattgtggccctcatgaccagaagagcatatgatttagctgggtcctgtaaa
ggagtcaaggtcatgtttaatgggaagaagttgcctgtaaatggatttcgcagctatgta
gacctttatgtgaaagacaaattggatgaaactggggtggctctcaaagttattcatgaa
cttgcaaatgaaagatgggatgtttgtctaaccttgagtgaaaaaggtttccagcagatc
agctttgtgaatagtattgcaactacaaaaggtgggcggcatgtggattatgtagtagat
caagttgttagtaaactgattgaagtagttaagaaaaagaacaaagctggtgtatcagtg
aaaccatttcaggttaaaaaccatatatgggtttttattaattgtcttattgaaaatcca
acctttgattctcaaactaaggaaaacatgactctgcagcccaaaagttttgggtccaaa
tgccaactgtcagaaaaattttttaaagcagcctctaattgtggcattgtagaaagcata
ttgaactgggtgaaatttaaggctcagactcaactgaataagaagtgttcatcagtaaag
tacagtaaaatcaaaggcattcccaaactggatgatgccaatgatgctggtggcaaacat
tccctggagtgtacattaatattaacagagggggactccgccaaatctctagctgtatct
ggattaggtgtgattggtagggacagatatggagtcttcccactcaggggtaaaattctc
aatgtacgagaagcctctcataaacagattatggaaaatgcagagataaataatattatt
aaaatagttggtttgcaatacaagaaaagttatgatgatgcagaatctctgaaaacttta
cgttatggaaagattatgattatgactgatcaggatcaagatggttctcacatcaaaggc
ctgctaatcaattttattcatcacaattggccatcacttttgaagcatggttttcttgaa
gaattcattactcccattgtaaaggcaagcaaaaataagcaggaactttccttttatagt
attcctgaatttgatgagtggaaaaaacatatagaaaaccagaaagcctggaaaataaag
tactacaaaggattaggtaccagtaccgctaaagaagcaaaggaatattttgctgatatg
gaaaggcatcgcattttgtttagatatgctggacctgaagatgatgctgccatcaccttg
gcatttagtaagaagaagattgatgacagaaaagagtggttaaccaactttatggaggat
cggagacagcgtaggttacatggcctaccagagcaatttttatatggtacagcaacaaag
catttgacatacaatgatttcatcaacaaggaattgattctcttctcaaactcggacaat
gagagatctatcccatctcttgtggatggcttcaagccaggtcaacgaaaagttttgttt
acctgtttcaagaggaatgataaacgtgaagtgaaagtagcgcagctggctggatctgtt
gctgagatgtctgcttaccaccatggagaacaagcattgatgatgactattgtgaatttg
gctcagaattttgtgggcagtaataacattaacttgcttcagcccattggtcagtttgga
actcggcttcatggtggcaaagatgctgcaagccctcgttatattttcacaatgttgagc
tctctggcaagacttctttttccagctgtggatgataacttgcttaagttcctttatgat
gataatcaacgtgtagagccagagtggtatatccctataatccccatggttttgattaat
ggtgctgagggtattgggactggatgggcttgtaaactgcccaactatgatgctagagaa
attgtgaacaatgtcaggcggatgctagaaggtttggatcctcatcccatgcttccaaac
tataagaacttcaaaggcaccatccaggaacttggtcagaaccagtatgctgttagtggt
gagatatttgtggtggacagaaacacagtagagattacagaacttccagttagaacatgg
acacaggtatacaaggagcaggtcctagaacctatgcttaatggaacagataaaacaccg
gcactgatttctgattacaaagaatatcatactgacacaactgtgaagtttgtggtgaaa
atgacagaagagaaactagcgcaagcagaagctgctggcctgcataaagtttttaaactt
caaactactcttacttgcaattccatggtactctttgatcatatgggttgtctgaagaag
tatgaaactgtgcaagacattttgaaagaattctttgatttacggttaagttattatggt
ttacggaaggaatggcttgtaggaatgctgggagcagaatctacaaagcttaataatcaa
gcccgtttcattttagagaagatacaggggaaaattactatagagaataggtcaaagaaa
gatttgattcaaatgttagtccagagaggttatgaatctgacccagtgaaagcgtggaaa
gaagcacaagaaaaggctgcagaagaggaagattcacaaaaccaacatgatgacagttcc
tctgattcaggaactccttcaggccctgattttaattatattttaaatatgtctctatgg
tctcttactaaagaaaaagttgaagaactcattaaacagagagatacgaaagggcgagag
gttaatgatctcaagaggaagtctccttcagatctttggaaagaagacttagcagcattt
gttgaagaattggataaagtggaagcacaagagcgggaagatattctggcaggaatgtct
gggaaagcaataaaaggtaaagtcggcaaacccaaagtaaagaaacttcagctggaggag
acaatgccctcgccttacgggagaagaattgttccagagattactgctatgaaggcagat
gccagcagaaaattgctgaagaagaaaaagggtgatcctgataccacagtagtgaaagta
gaatttgatgaagaatttagtggaacaccagcagaaggtacaggagaggagacattgacc
ccatctgctcctgtaaataaaggccccaaacccaaaagagagaagaaggagcctggtacc
agggttagaaaaacacctacatcaactggtaaaactaatgcgaagaaagtgaagaaacgg
aatccttggtcagatgatgagtccaaatcagagagtgacttggaagaagcagaacctgtg
gttatcccaagagattctttgcttaggagagcagctgctgaaagacctaagtacactttt
gatttctcagaagaggaggatgatgatgctgctgctgctgatgacagtaatgatttagaa
gaactgaaagttaaagcatctcccataacaaatgatggggaagatgaatttgttccttca
gatggcttagataaagatgagtatgctttttcttcaggcaaatccaaagctactccagaa
aaatcttcaaatgacaaaaaaagtcaggattttggaaatcttttttcatttccttcatat
tctcagaagtcagaagatgattcagctaaatttgacagtaatgaagaagataccgcttct
gtttttgctccatcatttggtctgaagcaaacagataaacttccaagtaaaacagttgct
gctaaaaagggtaaaccaccttcagatacagcccctaaagctaagagagcccctaaacag
aagaagatagtagagactataaactctgactcagactctgaatttggcattccaaagaag
actacaacaccaaaaggtaaaggccgaggggcaaagaaaaggaaagcatcaggctcagaa
aatgaaggtgattataaccctggaaggaaaccatctaaaacagccagcaagaaaccgaag
aaaacatcttttgatcaggattcagatgtagacatcttcccctcagacttcacttctgaa
ccaccggctctcccacggactggtcgggctaggaaagaagtaaaatattttgcagagtct
gatgaagaagaagatgttgattttgcaatgtttaattaa

DBGET integrated database retrieval system