KEGG   Mus musculus (mouse): 21982Help
Entry
21982             CDS       T01002                                 

Gene name
Tmem165, AV026557, Tpardl, Tparl, pFT27
Definition
(RefSeq) transmembrane protein 165
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 C3.3; 5 40.56 cM
AA seq 323 aa AA seqDB search
MAAAARGSGRAPTRRLLVLLLLQLLWAPAGVRAGPEEDLSHRNQEPPAPAQQLQPQPAAV
QGLEPARAEKGLTPVAPVHTNKEDAAAQTNLGFIHAFVAAISVIIVSELGDKTFFIAAIM
AMRYNRLTVLAGAMLALALMTCLSVLFGYATTVIPRVYTYYVSTALFAIFGIRMLREGLK
MSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPDVETGTSTAIPQKKWLHFISPIFVQAL
TLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTVT
IIGGIVFLAFAFSALFISPESGF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcggcccgggggagcggccgggcgccgacgcgaaggctgctcgtgctcttg
ctgcttcagttgctctgggccccggccggggtccgcgccggcccggaggaagacctgagc
catcggaaccaggagccgccggcgcccgcccagcagctgcagccgcagcccgcggcggtg
cagggcctcgagccggcccgggccgagaaaggattgacaccagtcgccccagttcatacc
aacaaagaagatgcagctgcccagacgaatctgggatttatccatgcgtttgtggctgcc
atatcagtcatcatagtgtccgaactcggcgacaagacgtttttcatagctgccatcatg
gcgatgcgctataaccggctgactgtgctggccggggccatgctggccttggccttgatg
acatgcttgtcggttttgtttggctatgccacaacagtcatccccagggtgtatacatac
tatgtttcaactgcactcttcgccatttttggcattagaatgcttcgggaaggtttgaag
atgagcccagatgagggtcaggaggagctagaagaagtccaagcagagttaaagaagaag
gatgaagaattccaacgaaccaaactcttaaatgggccagatgttgaaactggtacaagc
acagcaatacctcagaaaaagtggttacattttatttcacccatttttgttcaagcgctc
acattaacgttcttggcagaatggggcgatcgctctcaactcactaccattgtcctggca
gctagagaggacccttatggtgtagcagtgggtggcacagtgggacactgcttatgtact
ggattggcagtaattggaggaaggatgatagcgcaaaagatctctgtccgaactgtgaca
atcatcggaggcatcgtatttttggcgtttgcattttctgccctgtttataagtccagag
tctggtttttaa

DBGET integrated database retrieval system