KEGG   Mus musculus (mouse): 22025Help
Entry
22025             CDS       T01002                                 

Gene name
Nr2c1, 4831444H07Rik, 80.3, Eenr, TR2, Tr2-11
Definition
(RefSeq) nuclear receptor subfamily 2, group C, member 1
  KO
K08543  
testicular receptor 2
Organism
mmu  Mus musculus (mouse)
Brite
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    22025 (Nr2c1)
Nuclear receptors [BR:mmu03310]
 2. Hepatocyte nuclear factor 4 like
  2C. Testicular receptor
   22025 (Nr2c1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
10 C2; 10 48.81 cM
AA seq 590 aa AA seqDB search
MATIEEIAHQIIDQQMGEIVTEQQTGQKIQIVTALDHSTQGKQFILANHEGSTPGKVFLT
TPDAAGVNQLFFTSPDLSAPHLQLLTEKSPDQGPNKVFDLCVVCGDKASGRHYGAITCEG
CKGFFKRSIRKNLVYSCRGSKDCVINKHHRNRCQYCRLQRCIAFGMKQDSVQCERKPIEV
SREKSSNCAASTEKIYIRKDLRSPLAATPTFVTDSETARSAGLLDSGMFVNIHPSGIKTE
PAMLMAPDKAESCQGDLSTLASVVTSLANLGKAKDLSHCGGDMPVVQSLRNGDTSFGAFH
HDIQTNGDVSRAFDTLAKALTPGESSACQSPEEGMEGSPHLIAGEPSFVEKEGPLLSESH
VAFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALGQENSISLVKAYWNEL
FTLGLAQCWQVMNVATILATFVNCLHSSLQQDKMSPERRKSLMEHIFKLQEFCNSMVKLC
IDGHEYAYLKAIVLFSPDHPGLENMELIERFQEKAYVEFQDYITRTYPDDTYRLSRLLLR
LPALRLMNATITEELFFKGLIGNVRIDSVIPHILKMEPADYNSQIIGHSL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccatagaagaaattgcacatcaaattatcgaccaacagatgggtgagattgtt
acagagcagcagactggacagaaaatccagatcgtgacagcacttgaccacagcacacag
ggcaagcagttcattctggcaaaccacgagggatccacgccagggaaagtcttcctcaca
actccagacgccgcaggtgtcaaccagttgttttttaccagtcctgatctgtccgcaccg
cacctccagctcttaacagaaaagtctcctgaccagggaccaaataaggtttttgatctt
tgtgtcgtgtgtggagacaaagcatcagggcgtcattacggagcaataacttgtgaaggc
tgcaaaggattctttaaaagaagcatccggaaaaacctagtctattcctgtcgaggatcc
aaagactgcgttatcaataagcaccaccgaaaccgctgccagtactgcaggctgcagagg
tgcattgccttcgggatgaagcaagactctgttcagtgtgaaagaaaacccattgaagtt
tcccgagaaaaatcttccaactgtgcagcttcaacagaaaaaatctacatccgcaaagac
ctccgaagccctctagccgcaacgccaacctttgtaacagacagcgagactgccaggtca
gctggactgttggattcaggaatgtttgtgaatattcatccgtctggaataaaaacagag
ccagctatgctaatggcaccagataaggctgaatcgtgtcagggagacttaagcacattg
gccagtgtggtcacatcattagcgaatctcggcaaagctaaagacctttctcactgcggt
ggggatatgcctgtggtgcagagcttacgcaatggggatacatccttcggtgcttttcat
catgatattcagaccaatggggatgtttcaagggcatttgacactcttgcaaaagcactg
actcccggcgaaagctccgcctgccagagcccagaagagggcatggagggaagcccgcat
ctaatcgctggagagccaagcttcgtggagaaggaggggccgctgctgagcgagtcgcac
gtagctttcaggctcaccatgccttctcctatgcccgagtacctgaatgtgcactacatt
ggggagtcggcctccagactgctgttcttatcgatgcactgggcactttccataccttct
ttccaggcgctagggcaggagaacagcatatcactggtaaaagcgtattggaatgagctt
tttacccttggtcttgcccagtgctggcaagtgatgaacgtggcaactatattagcaacg
tttgtcaactgtcttcacagtagccttcagcaagataaaatgtccccggaaaggaggaag
tcgttgatggagcacatcttcaagctacaggagttctgcaacagcatggttaagctctgc
atcgatgggcatgagtacgcctacctcaaggccatcgtcctcttcagtcccgatcaccca
ggcctggagaacatggagctaattgagagatttcaggaaaaggcttatgtggaattccaa
gattatatcaccaggacatatccagatgacacctacaggctgtcgcgattacttctcaga
ctgcccgccttgcggctgatgaacgctaccattactgaggagttgttcttcaaaggtctc
attggcaacgtacggatcgacagtgttatcccacacattttaaaaatggagcctgcagat
tacaactctcaaataattggtcacagcctttga

DBGET integrated database retrieval system