KEGG   Mus musculus (mouse): 22030Help
Entry
22030             CDS       T01002                                 

Gene name
Traf2, AI325259
Definition
(RefSeq) TNF receptor-associated factor 2
  KO
K03173  
TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
NF-kappa B signaling pathway
Sphingolipid signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis
Osteoclast differentiation
RIG-I-like receptor signaling pathway
TNF signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hepatitis C
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    22030 (Traf2)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    22030 (Traf2)
   04064 NF-kappa B signaling pathway
    22030 (Traf2)
   04668 TNF signaling pathway
    22030 (Traf2)
   04071 Sphingolipid signaling pathway
    22030 (Traf2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    22030 (Traf2)
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    22030 (Traf2)
  Endocrine system
   04920 Adipocytokine signaling pathway
    22030 (Traf2)
  Development
   04380 Osteoclast differentiation
    22030 (Traf2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    22030 (Traf2)
   05203 Viral carcinogenesis
    22030 (Traf2)
   05222 Small cell lung cancer
    22030 (Traf2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    22030 (Traf2)
  Infectious diseases
   05160 Hepatitis C
    22030 (Traf2)
   05168 Herpes simplex infection
    22030 (Traf2)
   05169 Epstein-Barr virus infection
    22030 (Traf2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     22030 (Traf2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     22030 (Traf2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    22030 (Traf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2; 2 A3
AA seq 501 aa AA seqDB search
MAAASVTSPGSLELLQPGFSKTLLGTRLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTS
ILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKE
YESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYE
VCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRL
REHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTA
EACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISD
FTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDA
LLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEA
KNSYVRDDAIFIKAIVDLTGL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagccagtgtgacttcccctggctccctagaactgctacagcctggcttctcc
aagaccctcctggggaccaggttagaagccaagtacctctgttcagcctgcaaaaacatc
ctgcggaggcctttccaggcccagtgtgggcaccgctactgctccttctgcctgaccagc
atcctcagctctgggccccagaactgtgctgcctgtgtctatgaaggcctgtatgaagaa
ggcatttctattttagagagtagttcggcctttccagataacgctgcccgcagagaggtg
gagagcctgccagctgtctgtcccaatgatggatgcacttggaaggggaccttgaaagaa
tacgagagctgccacgaaggactttgcccattcctgctgacggagtgtcctgcatgtaaa
ggcctggtccgcctcagcgagaaggagcaccacactgagcaggaatgccccaaaaggagc
ctgagctgccagcactgcagagcaccctgtagccacgtggacctggaggtacactatgag
gtctgccccaagtttcccttaacctgtgatggctgtggcaagaagaagatccctcgggag
acgtttcaggaccatgttagagcatgcagcaaatgccgggttctctgcagattccacacc
gttggctgttcagagatggtggagactgagaacctgcaggatcatgagctgcagcggcta
cgggaacacctagccctactgctgagctcattcttggaggcccaagcctctccaggaacc
ttgaaccaggtggggccagagctactccagcggtgccagattttggagcagaagatagca
acctttgagaacattgtctgcgtcttgaaccgtgaagtagagagggtagcagtgactgca
gaggcttgtagccggcagcaccggctagaccaggacaagattgaggccctgagtaacaag
gtgcaacagctggagaggagcatcggcctcaaggacctggccatggctgacctggagcag
aaggtctccgagttggaagtatccacctatgatggggtcttcatctggaagatctctgac
ttcaccagaaagcgtcaggaagccgtagctggccggacaccagctatcttctccccagcc
ttctacacaagcagatatggctacaagatgtgtctacgagtctacttgaatggcgacggc
actgggcggggaactcatctgtctctcttcttcgtggtgatgaaaggccccaatgatgct
ctgttgcagtggccttttaatcagaaggtaacattgatgttgctggaccataacaaccgg
gagcatgtgatcgacgcattcaggcccgatgtaacctcgtcctccttccagaggcctgtc
agtgacatgaacatcgccagtggctgccccctcttctgccctgtgtccaagatggaggcc
aagaattcctatgtgcgggatgatgcgatcttcatcaaagctattgtggacctaacagga
ctctag

DBGET integrated database retrieval system