KEGG   Mus musculus (mouse): 22032Help
Entry
22032             CDS       T01002                                 

Gene name
Traf4, A530032M13Rik, CART1, msp2
Definition
(RefSeq) TNF receptor associated factor 4
  KO
K09848  
TNF receptor-associated factor 4
Organism
mmu  Mus musculus (mouse)
Pathway
IL-17 signaling pathway
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    22032 (Traf4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    22032 (Traf4)
   05222 Small cell lung cancer
    22032 (Traf4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11; 11 B5
AA seq 470 aa AA seqDB search
MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLP
LDYAKIYPDPELEVQVLGLAIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVVPCPNRCPAK
LSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGVCPQESVYCENKCGARMMRRLL
AQHATSECPKRTQPCAYCTKEFVYDTIQSHQYQCPRLPVPCPNQCGVGTVAREDLPTHLK
DSCSTAFVLCPFKESGCKHRCPKLAMGRHVEESVKPHLAMMCALVSRQRQELQELRRELE
ELSIGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEG
THLSIYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKP
GTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRASVELPRKILS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcttcgactacaagttcctggagaagcccaagcggcggctgctgtgcccactg
tgcgggaagcccatgcgcgagcctgtgcaggtgtctacttgtggccaccgcttctgcgac
acctgcctgcaggagtttctcagtgaaggagtcttcaaatgccctgaggaccaacttcct
ctggactatgccaagatctacccagacccagagctggaggtccaggtgttaggcttggct
atccgctgcatccacagtgaggagggctgccgctggagcgggccacttcgtcatctacag
ggccacttgaacacttgcagcttcaatgtagtcccctgccctaatcgctgcccagccaag
ctgagccggcgtgacctgcctgcccacctgcagcacgactgccctaagcgccgcctcaag
tgtgaattctgtggctgtgacttcagtggggaggcctacgagagtcacgagggcgtgtgc
ccccaagagagtgtgtactgtgagaacaagtgtggggcccgcatgatgaggcgactgttg
gcccagcatgccacgtctgagtgccccaagcgcacccagccctgtgcctactgtaccaag
gaatttgtttatgacaccatccagagccaccagtaccagtgcccacgcctgcctgttccc
tgccccaaccaatgtggagtgggcactgtggcccgggaagacctgcccacccatctgaag
gatagctgcagcactgcctttgttctctgccctttcaaagagtctggctgcaagcacagg
tgccctaagctggcaatgggacgtcacgtggaggagagcgtaaagccacatctggctatg
atgtgtgccctggtgagccgacagcggcaagagctgcaggagctgcgaagagagctggaa
gaactatccataggcagcgatggagtgctcatctggaagattggcagctatgggcgtcgt
ctacaagaggccaaggccaagcctaacctggagtgcttcagcccagccttctatacgcat
aagtacggctacaagctgcaggtgtctgcattcctcaacggcaacggcagtggtgagggc
acacacctctccatctacatccgtgtcttgccgggcgcctttgacaatctccttgagtgg
ccctttgcccgccgggtcaccttctccctgctggatcagagtgacccaggtttggctaag
ccacagcatgtcactgagaccttccaccctgatccaaactggaagaacttccagaagccc
ggcacgtggcgaggctccctggatgagagttctctgggcttcggctaccccaagttcatt
tcccaccaggacatccgaaagcggaactacgtgcgggatgatgcggttttcatccgtgcc
tctgtcgaactgccccggaagatcctcagctga

DBGET integrated database retrieval system