KEGG   Mus musculus (mouse): 22032Help
Entry
22032             CDS       T01002                                 

Gene name
Traf4, A530032M13Rik, CART1, msp2
Definition
(RefSeq) TNF receptor associated factor 4
  KO
K09848  TNF receptor-associated factor 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04657  IL-17 signaling pathway
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    22032 (Traf4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    22032 (Traf4)
   05222 Small cell lung cancer
    22032 (Traf4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-TRAF_2 zf-Nse zf-RING_5 zf-C3HC4_4 zf-RING_2 zf-RING_6 Sina zf-rbx1
Motif
Other DBs
NCBI-GeneID: 22032
NCBI-ProteinID: NP_033449
MGI: 1202880
Ensembl: ENSMUSG00000017386
Vega: OTTMUSG00000000106
UniProt: Q61382
Position
11; 11 B5
AA seq 470 aa AA seqDB search
MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLP
LDYAKIYPDPELEVQVLGLAIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVVPCPNRCPAK
LSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGVCPQESVYCENKCGARMMRRLL
AQHATSECPKRTQPCAYCTKEFVYDTIQSHQYQCPRLPVPCPNQCGVGTVAREDLPTHLK
DSCSTAFVLCPFKESGCKHRCPKLAMGRHVEESVKPHLAMMCALVSRQRQELQELRRELE
ELSIGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEG
THLSIYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKP
GTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRASVELPRKILS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcttcgactacaagttcctggagaagcccaagcggcggctgctgtgcccactg
tgcgggaagcccatgcgcgagcctgtgcaggtgtctacttgtggccaccgcttctgcgac
acctgcctgcaggagtttctcagtgaaggagtcttcaaatgccctgaggaccaacttcct
ctggactatgccaagatctacccagacccagagctggaggtccaggtgttaggcttggct
atccgctgcatccacagtgaggagggctgccgctggagcgggccacttcgtcatctacag
ggccacttgaacacttgcagcttcaatgtagtcccctgccctaatcgctgcccagccaag
ctgagccggcgtgacctgcctgcccacctgcagcacgactgccctaagcgccgcctcaag
tgtgaattctgtggctgtgacttcagtggggaggcctacgagagtcacgagggcgtgtgc
ccccaagagagtgtgtactgtgagaacaagtgtggggcccgcatgatgaggcgactgttg
gcccagcatgccacgtctgagtgccccaagcgcacccagccctgtgcctactgtaccaag
gaatttgtttatgacaccatccagagccaccagtaccagtgcccacgcctgcctgttccc
tgccccaaccaatgtggagtgggcactgtggcccgggaagacctgcccacccatctgaag
gatagctgcagcactgcctttgttctctgccctttcaaagagtctggctgcaagcacagg
tgccctaagctggcaatgggacgtcacgtggaggagagcgtaaagccacatctggctatg
atgtgtgccctggtgagccgacagcggcaagagctgcaggagctgcgaagagagctggaa
gaactatccataggcagcgatggagtgctcatctggaagattggcagctatgggcgtcgt
ctacaagaggccaaggccaagcctaacctggagtgcttcagcccagccttctatacgcat
aagtacggctacaagctgcaggtgtctgcattcctcaacggcaacggcagtggtgagggc
acacacctctccatctacatccgtgtcttgccgggcgcctttgacaatctccttgagtgg
ccctttgcccgccgggtcaccttctccctgctggatcagagtgacccaggtttggctaag
ccacagcatgtcactgagaccttccaccctgatccaaactggaagaacttccagaagccc
ggcacgtggcgaggctccctggatgagagttctctgggcttcggctaccccaagttcatt
tcccaccaggacatccgaaagcggaactacgtgcgggatgatgcggttttcatccgtgcc
tctgtcgaactgccccggaagatcctcagctga

DBGET integrated database retrieval system