KEGG   Mus musculus (mouse): 22037Help
Entry
22037             CDS       T01002                                 

Gene name
Trap1a, Tra-P1A
Definition
(RefSeq) tumor rejection antigen P1A
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X F1; X 61.35 cM
AA seq 224 aa AA seqDB search
MSDNKKPDKAHSGSGGDGDGNRCNLLHRYSLEEILPYLGWLVFAVVTTSFLALQMFIDAL
YEEQYERDVAWIARQSKRMSSVDEDEDDEDDEDDYYDDEDDDDDAFYDDEDDEEEELENL
MDDESEDEAEEEMSVEMGAGAEEMGAGANCACVPGHHLRKNEVKCRMIYFFHDPNFLVSI
PVNPKEQMECRCENADEEVAMEEEEEEEEEEEEEEMGNPDGFSP
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataacaagaagccagacaaagcccacagtggctcaggtggtgacggtgatggg
aataggtgcaatttattgcaccggtactccctggaagaaattctgccttatctagggtgg
ctggtcttcgctgttgtcacaacaagttttctggcgctccagatgttcatagacgccctt
tatgaggagcagtatgaaagggatgtggcctggatagccaggcaaagcaagcgcatgtcc
tctgtcgatgaggatgaagacgatgaggatgatgaggatgactactacgacgacgaggac
gacgacgacgatgccttctatgatgatgaggatgatgaggaagaagaattggagaacctg
atggatgatgaatcagaagatgaggccgaagaagagatgagcgtggaaatgggtgccgga
gctgaggaaatgggtgctggcgctaactgtgcctgtgttcctggccatcatttaaggaag
aatgaagtgaagtgtaggatgatttatttcttccacgaccctaatttcctggtgtctata
ccagtgaaccctaaggaacaaatggagtgtaggtgtgaaaatgctgatgaagaggttgca
atggaagaggaagaagaagaagaggaggaggaggaggaagaggaaatgggaaacccggat
ggcttctcaccttag

DBGET integrated database retrieval system