KEGG   Mus musculus (mouse): 22063Help
Entry
22063             CDS       T01002                                 

Gene name
Trpc1, Mtrp1, Trp1, Trrp1
Definition
(RefSeq) transient receptor potential cation channel, subfamily C, member 1
  KO
K04964  transient receptor potential cation channel subfamily C member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
mmu04724  Glutamatergic synapse
mmu04726  Serotonergic synapse
mmu04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    22063 (Trpc1)
  Nervous system
   04724 Glutamatergic synapse
    22063 (Trpc1)
   04726 Serotonergic synapse
    22063 (Trpc1)
  Development
   04360 Axon guidance
    22063 (Trpc1)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPC (Classical)
   22063 (Trpc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRP_2 Ion_trans Ank_2 Ank_4
Motif
Other DBs
NCBI-GeneID: 22063
NCBI-ProteinID: NP_035773
MGI: 109528
Ensembl: ENSMUSG00000032839
Vega: OTTMUSG00000047293
UniProt: Q61056 B2RPS7
Position
9 E3.3; 9 50.2 cM
AA seq 809 aa AA seqDB search
MGAPPPSPGLPPSWAAMMAALYPSTDLSGVSSSSLPSSPSSSSPNEVMALKDVREVKEEN
TLNEKLFLLACDKGDYYMVKKILEENSSGDLNINCVDVLGRNAVTITIENESLDILQLLL
DYGCQSADALLVAIDSEVVGAVDILLNHRPKRSSRPTIVKLMERIQNPEYSTTMDVAPVI
LAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPA
LIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEV
ILNHTSSDEPLDKRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRR
KPTCKKIMTVLTVGIFWPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASYFTFLLLLNLY
SLVYNEDKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNS
LYLATFALKVVAHNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILG
PLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQLYDKGYTSKEQKDCVGIFCEQQSNDTF
HSFIGTCFALFWYIFSLAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVVIVLTKLLVAM
LHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWICS
HTSKGKVKRQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNEL
RQDLSKFRNEIRDLLGFRTSKYAMFYPRN
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgggggccccgcctccgtctcctggcctgcccccgtcgtgggccgcgatgatggcggcc
ctgtacccgagcacggacctctcgggcgtctcctcctcctccctgccttcctccccatcc
tcctcgtcgcccaacgaagtgatggcgctgaaggatgtgcgagaggtgaaggaggagaac
accttgaatgagaagcttttcttgctggcgtgcgacaagggtgactattatatggttaaa
aagattttggaggaaaacagttcaggtgacttgaacataaattgcgtagatgtgcttggg
agaaatgctgttaccataactattgaaaacgaaagcttggacatactgcagctgcttttg
gactacggttgtcagtccgcagatgcacttttggtggcaatcgactctgaagtagtggga
gctgttgatatactacttaatcatcggccaaaacgatcatcaagaccaaccattgtaaaa
cttatggaacgaattcagaatccagaatattcaacaacgatggatgtcgcacctgttatt
ttagctgctcatcgtaacaactatgaaatccttacaatgcttttaaagcaggatgtgtct
ttgcccaagccccatgctgttggctgtgaatgcacactgtgttctgcaaaaaacaagaag
gacagcctcagacattccaggtttcgtcttgatatctatagatgtctggccagtccagct
ctgataatgttaacagaggaagatccaattctgagagcgtttgaacttagtgctgactta
aaggaactcagccttgtggaggtggaattcaggaatgattatgaagagctagcccgtcag
tgcaaaatgtttgctaaagatttgctcgcacaagcccggaattctcgtgaactggaagtt
atcctgaaccatacatctagcgatgagcctcttgacaaacgaggactactagaagaaaga
atgaacttaagtcgtctgaaacttgctatcaaatataaccagaaggagtttgtctcccag
tcaaattgccagcagttcctgaacacggtttggtttggacagatgtcaggttaccgccgt
aagcccacctgtaagaagataatgactgttttgacagttggcatcttctggccagttttg
tcactatgctatttgatagctcccaaatctcaatttggcagaatcattcacacacctttc
atgaaattcattattcatggagcatcgtatttcacattcttgctgttactaaatctctac
tcacttgtctacaatgaggacaagaaaaatacaatgggaccagccctggagagaatagat
taccttctcatactgtggattattgggatgatttggtcagacattaagagactgtggtat
gaagggttggaagacttcctagaagaatcgcgtaaccagctcagctttgttatgaattcc
ctttacttggcaacctttgccctcaaagtggtggctcacaacaagtttcatgactttgct
gaccggaaggactgggatgcattccaccccacgcttgtagcagaagggctttttgctttt
gcaaacgttctgagttaccttcgactcttttttatgtatacaaccagctctattttgggc
ccactgcagatttcaatgggacagatgttacaagattttgggaaatttctgggaatgttc
ctccttgttctgttttccttcacgattggactgactcagctctatgacaaagggtacact
tccaaagagcagaaggactgtgtgggcatcttctgcgaacagcaaagcaatgacaccttc
cactcgttcattggcacctgctttgctctgttctggtacatcttctccttagcgcacgtg
gccatctttgtcaccaggtttagctatggggaagagctgcagtccttcgttggagctgtg
attgttggaacttacaatgttgtggttgtgattgtgctgacgaagctgctcgtggcgatg
cttcacaagagcttccagctgatagcaaatcatgaggataaagaatggaagtttgctcga
gcaaagctatggcttagctactttgatgacaaatgtacactgcccccacctttcaacatt
attccttctccaaagacgatctgctatatgatcagtagcctcagtaaatggatttgctcg
catacctcgaaaggcaaggtcaaacgtcaaaacagtttaaaggagtggagaaacttgaag
caaaagagagacgagaactaccagaaggtgatgtgctgcctggtgcaccgctacctgacg
tccatgcgacagaagatgcagagcacagaccaggccaccgtggagaacctcaatgaactg
cgccaagatctgtcaaaattccgaaatgaaataagggatttgcttggctttcggacttct
aaatatgctatgttttatccaagaaattaa

DBGET integrated database retrieval system