KEGG   Mus musculus (mouse): 22064Help
Entry
22064             CDS       T01002                                 

Gene name
Trpc2, 3010009O07Rik, AI115608, TRPC2a, TRPC2b, Trrp2, mTrp2, smTRPC2, trp2
Definition
(RefSeq) transient receptor potential cation channel, subfamily C, member 2
  KO
K04965  
transient receptor potential cation channel subfamily C member 2
Organism
mmu  Mus musculus (mouse)
Brite
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPC (Classical)
   22064 (Trpc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 54.71 cM; 7 F1
AA seq 890 aa AA seqDB search
MDPLSPQPNWTEIVNKKLKFPPTLLRAIQEGQLGLVQQLLESSSDASGAGPGGPLRNVEE
SEDRSWREALNLAIRLGHEVITDVLLANVKFDFRQIHEALLVAVDTNQPAVVRRLLARLE
REKGRKVDTKSFSLAFFDSSIDGSRFAPGVTPLTLACQKDLYEIAQLLMDQGHTIARPHP
VSCACLECSNARRYDLLKFSLSRINTYRGIASRAHLSLASEDAMLAAFQLSRELRRLARK
EPEFKPQYIALESLCQDYGFELLGMCRNQSEVTAVLNDLGEDSETEPEAEGLGQAFEEGI
PNLARLRLAVNYNQKQFVAHPICQQVLSSIWCGNLAGWRGSTTIWKLFVAFLIFLTMPFL
CIGYWLAPKSQLGRLLKIPVLKFLLHSASYLWFLIFLLGESLVMETQLSTFKGRSQSVWE
TSLHMIWVTGFLWFECKEVWIEGLRSYLLDWWNFLDVVILSLYLASFALRLLLAGLAYMH
CRDASDSTTCRYFTTAERSEWRTEDPQFLAEVLFAVTSMLSFTRLAYILPAHESLGTLQI
SIGKMIDDMIRFMFILMIILTAFLCGLNNIYVPYQESEKLGNFNETFQFLFWTMFGMEEH
TVVDMPQFLVPEFVGRAMYGIFTIVMVIVLLNMLIAMITNSFQKIEDDADVEWKFARSKL
YLSYFREGLTLPVPFNILPSPKAAFYLVRRIFRFLCCGSSCCKAKKSDYPPIGTFTNPGA
RAGSAGEGERVSYRLRVIKALVQRYIETARREFEETRRKDLGNRLTELTKTVSRLQSEVA
SVQKNLAAGGAPRPPDGASILSRYITRVRNSFQNLGPPTSDTPAELTMPGIVETEVSLGD
GLDGTGEAGAPAPGEPGSSSSAHVLVHREQEAEGSGDLLLEGDLETKGES
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggaccccctttcgccacagcccaactggactgagattgtgaacaaaaagctcaaattc
ccccccacactcctgcgtgccatccaggagggccagctgggtcttgtgcagcagctgctg
gaatccagttccgatgcctcgggtgctgggccaggtggtcctctgcggaatgtggaagag
tctgaggaccgctcctggagggaagccctcaacctggccatccgcctgggccacgaggtc
atcactgatgttctgctggccaatgtcaaattcgactttcggcagatccacgaagccctg
ctagtggctgtggacacaaaccagccagcagtggtgcgtcgcctgctagcgcggctggag
cgggagaaaggtcgaaaagtagacaccaagtctttctctctagccttctttgactcatcg
attgatggctcccgctttgcccctggtgtcactccactcacactggcctgccagaaggac
ctgtatgagattgcccagctgcttatggaccagggccataccattgctcggccccaccca
gtttcctgtgcctgcctcgagtgcagcaatgcccgccgatacgacctgctgaagttctca
ctatcccgaatcaacacctaccgaggcattgcaagccgggctcacctctcgctggccagt
gaggatgccatgctggccgcttttcagctcagccgggagctcaggcgccttgcacgaaag
gagcctgagtttaagcctcagtacattgccctggagtctctctgccaggactatggcttc
gagttgctgggcatgtgccgaaatcagagtgaggtcaccgcagtgctcaatgacctgggt
gaggatagtgagactgagcctgaggctgagggcctgggtcaggcctttgaggagggcatc
cccaacctggcaagactgcggttggctgtcaactacaaccagaaacagtttgtagcacat
cccatctgccagcaagttctgtcttccatctggtgtgggaacctggctggctggcgtgga
agcaccaccatctggaagctctttgttgccttcctcatcttcctcaccatgcccttcctc
tgcattggctactggctggcgcccaagtcccagctgggccgcctgctgaagatcccggtg
ctgaagttcctgctgcattctgcctcctacctgtggttccttatcttcttgctgggagag
tctctggtcatggagacccagctgagcaccttcaaaggccgcagccagagtgtctgggag
acttcactacatatgatctgggtcacaggcttcctatggtttgaatgcaaggaggtgtgg
atcgagggcttgcggagctacctcctggactggtggaacttcctggacgtggtcatcctg
tccctgtacttggcatcctttgcactgcgcctcctcctggctgggcttgcctacatgcac
tgccgtgatgcctcagacagcaccacctgccgctatttcaccacagctgagagaagtgag
tggcgtacagaggacccccagtttctggctgaggtgctctttgctgtcaccagcatgctc
agcttcacccgactggcatatattctgccagctcacgaatcgctgggcacactgcagatc
tccatcggcaagatgattgacgacatgatccggttcatgttcatcctcatgatcatcctg
actgccttcctctgtggcctcaacaacatctatgtgccctaccaggaatccgagaagcta
ggcaatttcaacgaaacgttccagtttctcttttggaccatgttcggcatggaagagcac
acagtggtggacatgcctcagttcctggtgcctgagttcgtgggcagggccatgtacggc
atctttaccatcgtcatggtcattgtgctacttaacatgcttattgccatgatcaccaac
tccttccagaagatcgaggatgatgctgatgtggagtggaagtttgctcgctccaagctc
tacctgtcctacttccgagagggtctgacgctgcctgtgccctttaacatcctgccatcc
ccaaaggccgccttctacctcgtcaggagaattttccggttcctttgctgtggctcctcc
tgctgcaaagccaagaagtcggactacccgcccatcgggacctttaccaaccccggggca
agggcgggctccgccggggaaggagaacgcgtgtcctaccgccttcgagtcatcaaggct
ctggtgcagcgctacatagagactgcccggcgcgagttcgaggagacccgtcggaaagac
ctgggcaacagactgacagagctgaccaagactgtgtctcgactgcaaagcgaggtggcc
agtgtgcagaagaacctggcggcgggaggggcaccacggcctccggatggtgccagcatc
ctcagtagatacatcacccgagtgcgcaacagcttccagaacctgggcccccctacctct
gacaccccagcagagctgactatgcctgggattgtggagaccgaagtctctttaggagat
ggccttgatggcacaggtgaagctggagctcccgctcctggagagcccggctcttcctcc
tctgcccatgtgctggttcacagggagcaagaagcagaggggtcaggggacttgctcctg
gaaggagatctggagaccaagggcgagtcctaa

DBGET integrated database retrieval system