KEGG   Mus musculus (mouse): 22065Help
Entry
22065             CDS       T01002                                 

Gene name
Trpc3, Mwk, Trcp3, Trp3, Trrp3
Definition
(RefSeq) transient receptor potential cation channel, subfamily C, member 3
  KO
K04966  
transient receptor potential cation channel subfamily C member 3
Organism
mmu  Mus musculus (mouse)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Development
   04360 Axon guidance
    22065 (Trpc3)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPC (Classical)
   22065 (Trpc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3 B; 3 17.93 cM
AA seq 910 aa AA seqDB search
MSTKVKKCREPARVTLPAPEEEEDGEAEGGESQRRRRGWRGVNGGLEPPCPRAPPSPGPD
ASSEGSPSRWRTAGMRDKGRRQAVRGPAFMFGARGPSLTAEEERFLDAAEYGNIPVVRKM
LEESRTLNVNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARIGDALLLAISKGYVRIV
EAILGHPGFAASRRLTLSPCEQELRDDDFYAYDEDGTRFSPDITPIILAAHCHKYEVVHL
LLLKGARIERPHDYFCRCSDCAEKQRLDAFSHSRSRINAYKGLASPAYLSLSSEDPVLTA
LELSNELAKLANIEKEFKNDYRKLSMQCKDFVVGVLDLCRDSEEVEAILNGDLESAEPLE
RHGHKASLSRVKLAIKYEVKKFVAHPNCQQQLLTIWYENLSGLREQTIAIKCLVVLVVAL
GLPFLAIGYWIAPCSRLGKILRSPFMKFVAHAASFIIFLGLLVFNASDRFEGITTLPNIT
VIDYPKQIFRVKTTQFTWTEMLIMVWVLGMMWSECKELWLEGPREYIVQLWNVLDFGMLS
IFIAAFTARFLAFLQATKAQQYVDSHVQESDLSEVTLPPEVQYFTYARDKWLPSDPQIIS
EGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVLFIMVFLAFMIGMFIL
YSYYLGAKVNPAFTTVEESFKTLFWSIFGLSEVTSVVLKYDHKFIENIGYVLYGIYNVTM
VVVLLNMLIAMINSSYQEIEDDSDVEWKFARSKLWLSYFDDGKTLPPPFSLVPSPKSFVY
FIMRITNFSKCRRRRLQKDLELGMGNSKSRLNLFTQSNSRVFESHSFNSILNQPTRYQQI
MKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQATEELAILIHKLSE
KLNPSVLRCE
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccaaggtcaagaagtgccgggagcccgcgagggtgaccttgcccgctccggag
gaggaggaggatggcgaggccgagggaggcgagtcgcagcgccgccgccggggctggagg
ggcgtcaacggcgggctggagccgccctgcccgcgcgcgccgccgtccccggggcccgac
gcgtcgtcggagggcagcccatccaggtggcgcactgcggggatgcgtgacaagggccgg
cgccaggcagtgcgtggcccggccttcatgttcggtgctcgtgggcccagcctcacagct
gaggaggagcgcttcctggatgctgcggagtacggcaacatccctgtggtgcgcaagatg
ctggaggagtctcgcacgctcaatgtcaactgcgtggactacatgggccagaacgcactg
cagctggctgtaggcaatgagcatctggaggtgaccgagctgctgctgaagaaggagaac
ctggcgcggatcggtgatgcgctgctgctagccatcagcaagggctatgtgcgcatcgtg
gaggccatcctgggccacccaggctttgcagccagccggcgcctgaccctcagcccttgc
gagcaagaactgcgagatgatgacttctatgcttacgacgaggatggcacacgcttctcg
cctgacatcacgcccatcatcctggctgcacactgccataagtacgaggtggtgcacctg
ctgctactcaagggtgcacgcatcgagaggccacacgactacttctgtcgctgctctgac
tgcgctgagaaacaaaggcttgacgccttcagccactcaaggtctaggatcaatgcctac
aagggactggccagcccagcatacttgtcgctgtccagcgaggaccccgtgctcacagca
ctggagctcagcaatgagctggccaagctggccaacatagagaaggagttcaagaatgac
tacaggaaactctccatgcaatgcaaagacttcgtagtgggtgtgctggacctgtgtcgg
gactcggaggaggtggaagccattctgaatggagatctggaatcagccgagcccctggaa
agacacgggcacaaagcgtcactgagtcgtgtcaaacttgccattaagtatgaagtcaaa
aagtttgtggctcaccccaactgccaacagcagcttttgacaatctggtatgagaacctt
tccggcctccgggagcagaccatcgctatcaagtgtctggtcgtgttggtcgtggccttg
ggtcttccattcctcgccatcggctattggattgcaccttgtagcaggctggggaagatt
cttcgaagccccttcatgaagtttgtggcccacgctgcctccttcatcatctttctgggt
ctgcttgtattcaacgcctcggacagatttgaaggcatcaccacgctgccaaacatcact
gttatcgactaccccaagcaaatcttcagggtgaagaccacccagttcacgtggacggaa
atgttaattatggtctgggttcttgggatgatgtggtctgagtgcaaggagctgtggctg
gaggggccccgggagtacatcgtgcagttgtggaatgtgcttgatttcggcatgctctcc
atcttcatcgccgcgttcacagccaggttcctcgctttcctgcaggccacgaaggcgcag
cagtatgtggatagtcacgtgcaggagagcgatctgagcgaagtcacgctcccacctgag
gttcaatatttcacctatgctagagacaaatggctcccctcagaccctcagatcatatct
gaagggctctatgccatagctgtggtgctcagcttctcccggattgcgtacatcctccct
gcaaacgagagctttgggcccttgcagatctctcttggaaggactgtgaaggacatattc
aagttcatggttctcttcattatggtgttcctggctttcatgattggcatgttcatactt
tattcttactaccttggggccaaagtaaatcctgcttttaccacggttgaagaaagtttc
aagactttgttttggtccatatttggactgtctgaagtgacttctgttgtcctcaaatat
gatcacaaattcatagagaatattggctatgttctttatgggatatataatgtaactatg
gtggtcgttttactcaacatgctaattgctatgattaatagctcataccaagagatcgag
gatgacagtgatgtagaatggaagtttgctcgttccaaactttggctctcctacttcgat
gatggaaaaacattacctccacccttcagtctggtccctagtccaaaatcatttgtttac
ttcatcatgaggatcactaacttttccaaatgcaggaggagaagactgcagaaggatctg
gaactgggcatgggtaactcaaagtccaggttaaacctcttcacacagtctaactcgaga
gtttttgaatcacacagttttaacagcattctcaatcagccaacacgatatcagcagata
atgaaaagactcataaaacggtatgttttgaaagcacaagtagacaaagaaaacgatgag
gtgaatgaaggtgaactgaaagaaatcaagcaggatatctccagccttcgttatgaactt
ttagaagataagagccaagcgacggaggaattagccatcttgattcataaactcagtgag
aaactgaaccccagtgtgctgagatgtgagtga

DBGET integrated database retrieval system