KEGG   Mus musculus (mouse): 22067Help
Entry
22067             CDS       T01002                                 

Gene name
Trpc5, CCE2, TRP-5, TRP5, Trrp5
Definition
(RefSeq) transient receptor potential cation channel, subfamily C, member 5
  KO
K04968  
transient receptor potential cation channel subfamily C member 5
Organism
mmu  Mus musculus (mouse)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Development
   04360 Axon guidance
    22067 (Trpc5)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     22067 (Trpc5)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPC (Classical)
   22067 (Trpc5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X F2; X 65.49 cM
AA seq 975 aa AA seqDB search
MAQLYYKKVNYSPYRDRIPLQIVRAETELSAEEKAFLSAVEKGDYATVKQALQEAEIYYN
VNINCMDPLGRSALLIAIENENLEIMELLLNHSVYVGDALLYAIRKEVVGAVELLLSYRK
PSGEKQVPTLMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVE
CVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAE
YEELSQQCKLFAKDLLDQARSSRELEIILNHRDDHSEELDPQKYHDLAKLKVAIKYHQKE
FVAQPNCQQLLATLWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFI
KKPFIKFICHTASYLTFLFMLLLASQHIVRTDLHVQGPPPTVVEWMILPWVLGFIWGEIK
EMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVKYNGSRPREEWEMWHPTLIAEA
LFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYF
YYETRAIDEPNNCKGIRCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFV
GATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPP
FNIIPSPKSFLYLGNWFNNTFCPKRDPDGRRRRHNLRSFTERHADSLIQNQHYQEVIRNL
VKRYVAAMIRNSKTNEGLTEENFKELKQDISSFRYEVLDLLGNRKHPRRSLSTSSADFSQ
RDDTNDGSGGARAKSKSVSFNVGCKKKACHGAPLIRTVPRASGAQGKPKSESSSKRSFMG
PSFKKLGLFFSKFNGQTSEPTSEPMYTISDGIAQQHCMWQDIRYSQMEKGKAEACSQSQM
NLGEVELGEIRGAAARSSECPLACSSSLHCASGICSSNSKLLDSSEDVFETWGEACDLLM
HKWGDGQEEQVTTRL
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
atggcccagctgtactacaagaaggtcaattactcaccatacagagatcgcatccccctc
caaatcgtgagggctgagactgagctgtctgctgaggagaaagccttccttagtgctgtg
gagaagggggactatgccacagtgaagcaggcactgcaggaggccgagatctactacaat
gtcaacatcaactgcatggatcctttgggcaggagcgccctgctcattgccattgagaat
gagaacttggagatcatggagctactgctgaaccacagtgtgtatgtgggcgatgcatta
ctctacgccatccgcaaggaggtggtaggagctgtggaacttctgcttagctacaggaag
cccagtggagagaagcaggttcccacgctgatgatggacacccagttctctgagttcaca
ccagacatcactcccattatgttggcagcccacaccaacaactatgaaatcatcaaattg
cttgtccaaaagagggtcactatcccaaggccccaccagatccgctgcaactgtgtggag
tgtgtatccagttcggaggtagatagtctacgtcattctaggtcccgactgaatatatac
aaggctctggcaagcccctcgctcattgccttatcaagcgaggaccccatcctcacggcc
tttcggctgggctgggaactcaaggagctgagcaaagtggaaaatgagttcaaggctgag
tacgaggaactttcccagcaatgtaagctctttgccaaggatctcttggaccaagctcgg
agctccagagaactggagatcatcctcaaccatcgagatgaccacagtgaagaacttgac
ccacagaagtatcatgacctggccaagctgaaggtggcaatcaaatatcaccagaaagag
tttgtcgctcagccaaactgccaacaattgctagccaccttgtggtacgatggcttccct
ggatggcggagaaaacactgggtagtcaagcttctgacctgcatgaccattggattcctg
tttcctatgctgtccatagcctatctgatctcacccagaagcaaccttgggcttttcatc
aagaaaccctttattaagttcatctgccacacagcatcctatctgaccttcctcttcatg
cttctcctggcttctcaacatatcgtcagaacagacctccatgttcaaggacctccccca
actgttgtggaatggatgatactgccttgggttctaggtttcatttggggggagataaag
gaaatgtgggatggtggattcacggaatacatccatgattggtggaacctgatggatttt
gcaatgaactccctctacctggcaactatttccttgaagatcgtggcctatgtcaagtat
aatggttctcgtccaagggaagaatgggaaatgtggcacccgactctgattgcagaagca
ctcttcgcaatatccaacattttaagttccttgcgtctcatatccttgttcacagccaac
tcccatttagggcctctgcagatctctttgggacgaatgctgcttgatatactcaaattt
ctctttatctactgcctagtactactggcttttgccaacggactgaaccagctttacttt
tactatgagaccagagctattgatgaacctaacaactgcaaggggatccgatgtgaaaaa
cagaacaacgccttctccacgctctttgaaacccttcagtcgctcttctggtctgtcttt
ggcctcctaaatctctatgttaccaatgtgaaggcccgacatgagttcactgagtttgtg
ggagctacgatgtttgggacatacaacgtcatctccctggtagtgctgctgaatatgctc
atcgccatgatgaacaactcctaccagctcattgccgatcatgctgatattgagtggaag
tttgcgagaacaaagctctggatgagttactttgatgaaggtggcaccttaccacctcct
ttcaacattattcccagccccaaatcatttctctatcttggcaactggttcaacaacacc
ttctgtcccaaaagagaccctgatggaagacgaaggaggcacaacttgagaagcttcaca
gaacgtcatgctgacagcctgatacaaaatcaacattatcaggaagttatcagaaattta
gtcaagagatatgtggctgcaatgataagaaactccaaaacaaatgaggggctaacagaa
gaaaattttaaggaattaaagcaggacatttccagctttcgatatgaagtgcttgacctc
ttgggaaacaggaaacatccaagaagaagcctctccaccagcagtgctgatttctctcaa
agggatgataccaatgacggcagtggtggggctcgggccaagtctaagagtgtctctttc
aatgtaggctgcaagaaaaaggcctgtcacggtgcaccgctcatcagaaccgtgccaaga
gctagtggcgcccaaggaaagccaaaatccgagtcgtcgagcaaacggtccttcatgggt
ccgtctttcaagaaattgggtctcttcttctccaagttcaatggtcaaacatctgaacct
acttcggagccaatgtacacaatctctgatggcatcgcacagcagcattgtatgtggcag
gacatccgctattctcagatggagaaagggaaggcagaggcctgttctcaaagtcagatg
aaccttggcgaggtagagctaggtgaaatccggggggctgctgctcggagcagtgagtgc
cccctagcctgttccagctcccttcactgtgcatccggcatctgctcctcaaattcgaaa
cttttggactcgtcagaggacgtatttgaaacttggggagaggcttgtgacttgctcatg
cacaaatggggtgatggacaggaagaacaagttacaactcggctctaa

DBGET integrated database retrieval system