KEGG   Mus musculus (mouse): 22068Help
Entry
22068             CDS       T01002                                 

Gene name
Trpc6, AV025995, LLHWJM002, LLHWJM003, LLHWJM004, TRP-6, Trrp6, mtrp6
Definition
(RefSeq) transient receptor potential cation channel, subfamily C, member 6
  KO
K04969  
transient receptor potential cation channel subfamily C member 6
Organism
mmu  Mus musculus (mouse)
Pathway
cGMP-PKG signaling pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    22068 (Trpc6)
 Organismal Systems
  Development
   04360 Axon guidance
    22068 (Trpc6)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPC (Classical)
   22068 (Trpc6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
9 A1; 9 2.46 cM
AA seq 930 aa AA seqDB search
MSQSPRFVTRRGGSLKAAPGAGTRRNESQDYLLMDELGDDGYPQLPLPPYGYYPSFRGNE
NRLTHRRQTILREKGRRLANRGPAYMFNDHSTSLSIEEERFLDAAEYGNIPVVRKMLEEC
HSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLSRVGDALLLAISKGYVRIVEAIL
NHPAFAEGKRLATSPSQSELQQDDFYAYDEDGTRFSHDVTPIILAAHCQEYEIVHTLLRK
GARIERPHDYFCKCTECSQKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVMTALELS
NELAVLANIEKEFKNDYRKLSMQCKDFVVGLLDLCRNTEEVEAILNGDAETRQPGDFGRP
NLSRLKLAIKYEVKKFVAHPNCQQQLLSIWYENLSGLRQQTMAVKFLVVLAVAIGLPFLA
LIYWCAPCSKMGKILRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKLLPNETSTDNAR
QLFRMKTSCFSWMEMLIISWVIGMIWAECKEIWTQGPKEYLFELWNMLDFGMLAIFAASF
IARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPTDPQIISEGLYAI
AVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYIG
AKQNEAFTTVEESFKTLFWAIFGLSEVKSVVINYNHKFIENIGYVLYGVYNVTMVIVLLN
MLIAMINSSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLVPSPKSLLYLLLKFK
KWMCELIQGQKQGFQEDAEMNKRNEEKKFGISGSHEDLSKFSLDKNQLAHNKQSSTRSSE
DYHLNSFSNPPRQYQKIMKRLIKRYVLQAQIDKESDEVNEGELKEIKQDISSLRYELLEE
KSQNTEDLAELIRKLGERLSLEPKLEESRR
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgagccagagcccgaggttcgtgacccggaggggcggctctctaaaggctgcccctgga
gccggcacccggcgcaacgagagccaggactatttgctgatggacgagctgggagacgac
ggctacccgcagctcccgctgccaccgtatggctactaccccagcttccggggtaatgaa
aacagactgactcaccggcggcagacgattcttcgtgagaagggaagaaggttagctaat
cgaggaccagcatacatgtttaatgatcattcaacaagcctgtctattgaggaagaacgc
tttctagatgcagctgaatatggcaacatcccagtggtgcggaagatgctagaagagtgt
cattccctcaatgttaactgtgtggattacatgggccagaatgccctacagctggctgtg
gccaatgagcacttggaaatcacagagctgctactcaagaaggaaaacttgtctcgagtt
ggggatgctttacttttagccattagtaaaggttatgtacggattgtggaggcaatcctc
aaccatccagcttttgctgaaggcaaaaggttagcgacaagccccagccagtctgaactt
cagcaagatgacttttatgcctatgatgaagatgggacgcggttctcccatgatgtgacc
ccaatcattctcgctgcacattgccaggaatatgaaattgtgcataccctcctgagaaag
ggtgcccggattgagcggcctcatgattacttctgcaagtgtacagaatgcagccagaag
cagaagcatgattccttcagccactctagatccaggatcaatgcatacaaaggtctggca
agtccagcatacctgtcattgtccagtgaagatccagtcatgactgctttagaacttagc
aatgagctggcagtgcttgccaacattgagaaagagttcaagaatgactacaggaagctg
tctatgcagtgcaaggatttcgttgttggtctcttggacctctgcagaaacacagaggaa
gtggaggccatcctgaatggggatgcagagactcgccagcccggggacttcggccgtcca
aatctcagccgtttaaaacttgctattaagtatgaagtaaaaaaatttgtggctcatcca
aactgtcagcaacagctcctgtccatatggtatgagaacctctctggtttacggcagcag
accatggcagtgaagttcctcgtggtccttgctgttgccattggattgcccttcctggct
ctcatatactggtgtgctccttgcagcaagatggggaagatattgcgaggaccgttcatg
aagtttgtagcacacgcagcctccttcaccattttcctggggctgctcgtcatgaatgca
gctgacagatttgaaggcaccaagctcctccctaatgaaaccagcacagataatgcaagg
cagctgttcaggatgaaaacatcctgtttctcatggatggagatgctcattatatcctgg
gtaataggcatgatatgggctgaatgtaaagaaatctggactcaaggccccaaagaatac
ttatttgagttgtggaatatgcttgactttggaatgctggcaatctttgcagcatcattc
attgcaagatttatggcgttctggcatgcatccaaagctcagagcatcattgatgcaaat
gatactttaaaggatttgacaaaagtcacactgggggacaacgttaaatactacaatctg
gccaggataaagtgggaccctactgatcctcagatcatctctgaaggtctttatgcaatc
gctgtggttttaagtttctccagaatagcttacattttaccagcaaatgaaagctttgga
cctctgcagatttcacttggaagaacagtgaaagatatcttcaaattcatggtcatattc
atcatggtgtttgtagcctttatgattggaatgttcaacctttactcctactacattggc
gcaaaacagaatgaagcattcacaacagttgaggaaagttttaagacactgttctgggct
atctttggtctttctgaagtgaagtcagtggtcattaactacaatcacaagttcattgaa
aacatcggctacgttctgtatggtgtctataatgtcacaatggtcattgttttgctaaat
atgttaattgcgatgatcaatagttcattccaggaaattgaggatgatgcggacgtggag
tggaagtttgcaagggccaaattgtggttttcctactttgaggaggggagaacacttcct
gtccccttcaatcttgtaccaagtccaaaatccttgctttatctcctattgaaatttaag
aaatggatgtgtgagctcatccagggtcaaaagcaaggcttccaagaagatgcagagatg
aacaagagaaatgaagaaaagaaatttggaatttcaggaagtcacgaagacctttcaaaa
ttttcacttgacaaaaatcagttggcacacaacaaacaatcaagtacaaggagctcagaa
gattatcatttaaatagtttcagtaaccctccaagacaatatcagaaaatcatgaagaga
ctcattaaaagatatgtattgcaggcccagattgataaggagagcgatgaggtgaatgaa
ggggaattgaaggaaattaagcaagacatctcaagtctccgttatgaactccttgaagag
aaatcacagaacacagaagacctagcagagctcattagaaaactcggggagagactgtcg
ttagagccaaagctggaggaaagccgcagatag

DBGET integrated database retrieval system