KEGG   Mus musculus (mouse): 22074Help
Entry
22074             CDS       T01002                                 

Gene name
Try4, 0910001B19Rik, Td
Definition
trypsin 4
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    22074 (Try4)
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    22074 (Try4)
   04974 Protein digestion and absorption
    22074 (Try4)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    22074 (Try4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     22074 (Try4)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   22074 (Try4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   22074 (Try4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 B1; 6
AA seq 246 aa AA seqDB search
MRALLFLALVGAAVAFPVDDDDKIVGGYTCRENSVPYQVSLNSGYHFCGGSLINDQWVVS
AAHCYKSRIQVRLGEHNINVLEGNEQFVNSAKIIKHPNFNSRTLNNDIMLIKLASPVTLN
ARVATVALPSSCAPAGTQCLISGWGNTLSFGVNNPDLLQCLDAPLLPQADCEASYPGKIT
NNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQ
NTIAAN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagagcactcctgttcctggcccttgtgggagctgctgttgctttccctgtggatgat
gatgacaagatcgttggaggatacacctgccgagagaattctgtcccctaccaggtgtcc
ctgaactctggctaccacttctgtggaggttccctcatcaatgaccagtgggtggtgtct
gcagctcactgctacaagtcccgcatccaagtgagactgggagagcacaacatcaatgtc
ctcgagggcaatgagcagtttgtcaattctgccaagatcatcaagcatcccaacttcaat
agcaggaccctgaacaacgacatcatgctgatcaaactggcttcccctgtgaccctcaat
gccagagtggccactgtggctctgcccagctcctgtgcacctgcaggcactcagtgtctc
atctctggctggggcaacaccttgagctttggtgtgaacaacccagacctgctccagtgc
ctggatgccccactgctgcctcaggctgactgtgaggcctcctatcctggaaagatcacc
aataacatgatctgtgttggcttcctagagggaggcaaagattcctgccagggtgactct
ggtggccctgtggtctgcaatggacagctccagggcattgtctcctggggctatggctgt
gccctgaaggacaaccctggtgtgtacaccaaggtctgcaactatgtggactggattcaa
aacaccattgctgcaaactaa

DBGET integrated database retrieval system