KEGG   Mus musculus (mouse): 22114Help
Entry
22114             CDS       T01002                                 

Gene name
Tssk1, Stk22a, TSK-1, Tsk1, Tssk, Tssk1b
Definition
(RefSeq) testis-specific serine kinase 1 (EC:2.7.11.1)
  KO
K08811  
testis-specific serine kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     22114 (Tssk1)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CAMK group
  TSSK family
   22114 (Tssk1)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    22114 (Tssk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
16 A3; 16 11.09 cM
AA seq 365 aa AA seqDB search
MDDAAVLKRRGYIMGINLGEGSYAKVKSAYSERLKFNVAVKIIDRKKAPSDFLEKFLPRE
IEILAMLNHRSIVKTYEIFETSDGKVYIVMELGVQGDLLEFIKTRGALQEDDARKKFHQL
SSAIKYCHDLDVVHRDLKCENLLLDKDFNIKLSDFGFSKRCLRDDSGRLILSKTFCGSAA
YAAPEVLQGIPYQPKVYDIWSLGVILYIMVCGSMPYDDSNIKKMLRIQKEHRVNFPRSKH
LTGECKDLIYRMLQPDVNRRLHIDEILNHCWVQPKARGLSSGAINKEGESSRATEPSWIP
EPGADKKSATKLEPREEARSEARSESKPQEDTLQVVRQSENVGLSSELNRDTEEGHPQQP
SETHT
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggatgacgctgccgtcctcaagcgacgaggctacatcatggggataaacttgggagag
ggctcatatgccaaagtcaaatccgcttactctgagcgcctaaagttcaacgtggcggtc
aagatcatcgatcgcaagaaagccccctcagacttcctggagaaattccttccccgggag
attgagattctggccatgctaaaccaccgctctattgtcaagacctatgagatctttgag
acatcagatggcaaggtctacattgtcatggagcttggggtccagggtgacctcctcgag
ttcatcaaaaccagaggagccctgcaagaggatgatgctcgaaagaagttccaccagctc
tcctcggccatcaagtactgccacgacctggatgtcgtccaccgagacctcaaatgtgag
aaccttctgcttgacaaggacttcaacatcaaactgtctgacttcggcttctccaagcgc
tgcttgcgggatgatagtggtcgactgatattaagcaagaccttctgtgggtcagcagct
tatgcggcccccgaggtgctgcagggcatcccctaccagcccaaggtgtatgacatctgg
agcctgggtgtgattctctacatcatggtctgtggctccatgccctacgatgactccaac
atcaaaaagatgctgcgcatccagaaggagcaccgtgtcaactttccacgctctaaacac
ctgactggtgagtgcaaggacctcatctacagaatgttacagccagatgtcaaccgccgg
ctgcacatcgatgagatccttaaccactgctgggtgcagcccaaggcacgaggtctgtcc
tctggagccatcaacaaggagggggaaagctcccgggccactgagccctcatggatccct
gaacctggtgctgataagaagtctgccaccaagttggagcctagggaagaggcacgatct
gaggcccggtctgagtcaaaaccccaggaagatactttgcaggtggtcaggcagtcagag
aacgtgggcctcagcagcgaactgaacagggacacagaggaagggcacccccaacagcct
tcagagacacatacttag

DBGET integrated database retrieval system