KEGG   Mus musculus (mouse): 22137Help
Entry
22137             CDS       T01002                                 

Gene name
Ttk, AL022661, Esk1, Mps1, PYT, esk
Definition
Ttk protein kinase (EC:2.7.12.1)
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    22137 (Ttk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     22137 (Ttk)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Other group
  TTK family
   22137 (Ttk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9 E2; 9
AA seq 815 aa AA seqDB search
MEAEELIGSSVTIDSIMSKMRDIKNKINEDCTDELSLSKICADHTETVNQIMRVGNTPEN
WLNFLLKLEKNSSPLNDDLLNKLIGRYSQAIEVLPPDKYGQNESFARIQVRLAELKAIQE
PDDARDYFQMARENCKKFAFVHVSFAQFELSQGNLKKSEQLLHKAVETGAVPLQMLETAM
RNLHLQKKQLLPEEDKKSVSASTVLSAQEPFSSSLGNVQNRSISCESRGQAGAARVLYGE
NLPPQDAEVRHQNPFKQTHAAKRSCPFGRVPVNLLNSPDFYVKTDSSAVTQLTTRKGSGP
DRDAILPGSRPRGSDSYELRGLKPIQTIYLKDSLVSNEKSSELMSDLIALKSKTDSSLTK
LEETKPEIAERRPMQWQSTRKPECVFQNPAAFAPLRHVPDVTPKADKESPPISVPKWLDP
KSACETPSSSSLDDYMKCFKTPVVKNDFPPACPSSTPYSQLARLQQQQQQGLSTPLQSLQ
ISGSSSINECISVNGRIYSILKQIGSGGSSKVFQVLNEKKQINAIKYVNLEDADSQTIES
YRNEIAFLNKLQQHSDKIIRLYDYEITEQYIYMVMECGNIDLNSWLKKKKSINPWERKSY
WKNMLEAVHIIHQHGIVHSDLKPANFVIVDGMLKLIDFGIANQMQPDTTSIVKDSQVGTV
NYMAPEAIRDMSSSRENSKIRTKVSPRSDVWSLGCILYYMTYGRTPFQHIINQVSKLHAI
INPAHEIEFPEISEKDLRDVLKCCLVRNPKERISIPELLTHPYVQIQPHPGSQMARGATD
EMKYVLGQLVGLNSPNSILKTAKVSACTLLPAVLM
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atggaggctgaagagttaattggcagcagtgtgacgattgattccatcatgagcaaaatg
agagatattaaaaataagataaatgaagactgtactgatgagctaagcttgtctaaaatc
tgtgccgatcacacggaaactgttaaccaaattatgagggttgggaacaccccagagaac
tggttgaatttcttgctgaaactagagaaaaacagctcacctctaaatgacgatctttta
aataagctgattggtcggtatagtcaagcgattgaagtacttcctccagataaatacggc
cagaatgagagctttgctcgaatacaagtgagacttgctgaactaaaagctattcaagag
cctgatgatgcccgtgactacttccagatggccagggaaaactgcaagaagtttgctttt
gtgcacgtatcttttgcacagtttgaactgtctcaaggcaatcttaaaaaaagtgagcag
cttcttcataaagctgtagagactggggcggtgccgctgcagatgctggagacggccatg
cgtaacttacacctccagaaaaagcagctgcttccggaggaggacaagaagagtgtgtca
gcatcgacagtactaagtgcccaagagccgttctccagctcacttggaaatgtacagaat
cggagcatcagctgtgagtccagaggacaggctggggcagccagggttttatatggagag
aacttgcctccacaagatgccgaagtgaggcatcaaaaccccttcaagcagactcacgca
gctaaacggtcatgcccctttggaagagtcccagtcaatcttctaaacagcccagatttc
tatgtgaagacagatagctcagctgtgacacagttaacaacaagaaaggggtcaggacca
gaccgagacgcgattctgcccggctccagaccacgtggcagtgattcctatgaactgaga
ggtttaaagcccattcaaactatctatttgaaagactctttggtgtccaatgaaaagagt
tctgaacttatgtctgatttaatagccttgaagagtaaaacagattcaagtctaacaaaa
ttggaagaaactaagccagagattgcagaaagaaggcccatgcagtggcagtctaccaga
aagcccgagtgtgtgttccagaaccctgctgcctttgcacccctgcggcacgttccagat
gtcaccccgaaggctgacaaagagtcaccaccaatatcagttcctaaatggcttgatcca
aagtctgcttgtgagacacctagtagcagctccttggatgattacatgaaatgttttaag
actccagttgtaaagaatgactttccacctgcctgtccatcatcaacaccttacagccag
cttgcccgcctccagcagcaacagcagcagggactcagcactcctcttcaaagcttgcag
atttcaggttcttcatcaataaatgaatgcatttcagttaacggaagaatttattccata
ttaaagcagataggcagtggaggttccagtaaggtgtttcaggtattgaatgagaaaaaa
cagataaacgctatcaaatatgtgaacctagaagacgccgatagccaaactattgagagc
taccgcaacgagatagcgtttttgaacaaactacagcaacacagtgataagatcatccgc
ctctatgattatgaaatcaccgagcagtacatctacatggtaatggaatgtggaaacatt
gacctaaatagttggcttaaaaagaaaaaatccatcaatccatgggaacgcaagagctac
tggaaaaacatgttggaggcagtacacataatccatcagcatggtattgttcatagtgat
ctgaagcctgctaactttgtgatagtggatggaatgctaaagctaattgattttgggatt
gcaaaccaaatgcagccagacacaacaagcattgttaaagattctcaggttggcacagtt
aactatatggccccagaagcaatcagagacatgtcttcttcaagagaaaattcgaaaatc
aggaccaaggtaagtcccagaagtgatgtctggtccttggggtgcattttgtactacatg
acttatgggaggacgccatttcagcacatcatcaatcaggtctctaaactgcacgccata
atcaaccctgctcatgagattgaatttcccgagatttcggaaaaagatcttcgagacgtg
ttaaagtgctgtttagtgaggaaccctaaagagaggatatctatccctgagcttctcaca
catccgtatgttcaaattcagccccatccaggcagccaaatggctaggggagccactgat
gaaatgaaatatgtgttgggtcaacttgttggtctgaattctcctaactccatcttgaaa
actgcaaaagtgagtgcatgtacattacttccagctgttttaatgtaa

DBGET integrated database retrieval system