KEGG   Mus musculus (mouse): 22138Help
Entry
22138             CDS       T01002                                 

Gene name
Ttn, 1100001C23Rik, 2310036G12Rik, 2310057K23Rik, 2310074I15Rik, AF006999, AV006427, D330041I19Rik, D830007G01Rik, L56, mdm, shru
Definition
(RefSeq) titin (EC:2.7.11.1)
  KO
K12567  
titin [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    22138 (Ttn)
   05414 Dilated cardiomyopathy (DCM)
    22138 (Ttn)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     22138 (Ttn)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CAMK group
  MLCK family
   22138 (Ttn)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     22138 (Ttn)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   22138 (Ttn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 45.13 cM; 2 D
AA seq 33467 aa AA seqDB search
MTTQAPMFTQPLQSVVVLEGSTATFEAHVSGSPVPEVSWFRDGQVISTSTLPGVQISFSD
GRARLMIPAVTKANSGRYSLRATNGSGQATSTAELLVTAETAPPNFSQRLQSMTVRQGSQ
VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN
SVGRATSTAELVVQGEEVVPAKKTKTIVSTAQISETRQTRIEKKIEAHFDARSIATVEMV
IDGATGQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPTP
SPVRSVSPAGRISTSPIRSVKSPLLIRKTQTTTMATGPEVPPPWKQEGYVASSTEAEMRE
TTMTSSTQIRREERWEGRYGVQEQVTISGAAAAAASASVSSSFTAGAITTGTKEVKQETD
KSAAVATVVAAVDMARVREPAISAVEQTAQRTTTTAVHIQPAQEQARKEAEKTAVTKVVV
AADKAKEQELKSRTREVMVTTQEQTHISHEQIRKETEKAFVPKVVISATKAKEQETRITG
EITTKQEQKRITQETIRQETEEIAASMVVVATAKSTKLEAAVGVQEETAIQQDQMHLTHE
QMMKETRKTVVPKVIVATPKIKEQDLVSRSREAITTKRDQVQITQEKKRKEVETTALSTI
AVATAKAKEQETVLRSREAMATRQEHIQVTHGQVGVGKKAEAVATVVAAVDQARVREPRE
PTHVEESHSQQTTLEYGYKEHISTTKVPEQPRRPASEPHVVPQAVKPAVIQAPSETHIKT
TDQMGMHISSQVKKTTDISTERLVHVDKRPRTASPHFTVSKISVPKTEHGYEASIAGSAI
ATLQKELSATSSTQKITKSVKAPTVKPGETRVRAEPTPSPQFPFADMPPPDTYKSQAGIE
VKKEVGVSISGSTVREEHFEVLRGREAKVTETARVPAPAEVPVTPPTLVSGLKNVTVIEG
ESVTLECHISGYPSPKVTWYREDYQIESSIDFQITFQGGIARLMIREAFAEDSGRFTCSA
VNEAGTVSTSCYLAVQVSEEFDKETTLTEKFATEEKRFVESRDVVMTDTSITEEQAGPGE
PAAPFFISKPVVQKLVEGGSVVFECQIGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGE
CRLVISMTFADDAGEYTIVIRNKHGETSASASLLEEADYEALVKTQQEMLYQTQMSTFIQ
EPKVGEIAPGFAYSEYEKEYEKEQALIRKKMAKDTVMVRTFVEDQEFHISSFEERLIKEI
EYRIIKTTLEELLEEDGEEKMAVDISESEAIESGFDIRIKNYRILEGMGVTFHCKMSGYP
LPKIAWYKDGKRIRHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGK
LYVEPAAPFSAPTYMPTPEAVSRIRSVSPRSLSRSPIRMSPAMSPARMSPARMSPARMSP
ARMSPGRRLEETDESQLERLYKPVFVLKPASFKCLEGQTARFDLKVVGRPMPETFWFHNG
QQIVNDYTHKVVIKEDGTQSLIIVPASPSDSGEWTVVAQNRAGKSTISVTLTVEAVEHQI
KPAFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPRIRIEGTRGEAA
LKIDSIISQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAA
PELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTM
VVEWLHDGKPLEAANRLRMINEFGYCSLDYGAAYSRDSGVITCRATNKYGTDHTSATLIV
KDEKSLVEESQLPDGKKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLFPEPVRVLE
GETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVKVTA
ENPEGVTEHKVKLEIQQREDFRSVLRRAPEPKPEFHVHEPGKLQFEVQKVDRPVDTSETK
EVVKLKRAERITHEKVSEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLKKT
KDELLHWTKELTEEEKKALAEEGKITIPTFKPERIELSPSMEAPKIFERIQSQTVGQGSD
AHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAI
NIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFIKVKWYKDGIEV
HAGDKYRMHSDRKVHFLSVLTIDTSDAEDYSCVLVEDENIKTTAKLIVEGAVVEFVKELQ
DIEVPESYSGELECIISPENIEGKWYHNDVELKSNGKYSITSRRGRQNLTVKDVTKEDQG
EYSFVVDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLENVEGVWMKDGQE
VQHSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGNVSVYSVDVITPLKDV
NVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQSIVKGTKQRLVINRTHASDEGP
YKLMVGRVETSCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVVWNFKGKEIKP
SSKYKIEAHGKIYKLTVLNMMKDDEGEYAFYAGENTTSGKLTVAGGAISTPLTDQTVAES
QEAVFECEVANPESEGEWLKDGKHLALSNNFRGESDGHKRRLVIAAAKLDDAGEYTYKVA
TSKTSAKLKVEAVKIKKTLRNLTVTETQDAVFSVELTHPDVKGVQWIKNGVVLDSNDKYE
ISVKGTLYSLKIKNCAMADESVYGFKLGRLGASARLHVETVKIIKKPKDVTALENATVTF
EVSVSHDTVPVKWFHKNVEIKPSDKHRLVSERKVHKLMLQSISPSDAGEYTAMVGQLECK
AKLFVETLHITKTMKSIEVPETKAASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGK
LHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNY
EGISYKWLKNGVEIKSTDRCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVE
ARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDGQELQIADRIKIQKEKYVHRL
LIPSTRMSDAGKYTVVAGGNMSTANLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDD
VDAHWYKDGIEINFQVQERHQYVVERRIHRMFISETRHSDAGEYTFVAGRNRSSVTLYVN
APEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEY
TLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIVTPLQDT
VTSEGRPARFQCQVSGTDLKVSWYCKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTY
AFVANNAVGQVSSTATLRLEAPESILHERIGQQIEMEMKAAPVIKRRIEPLEVALGHLAK
FTCEIQGAPNVRFQWFKAGREIYESDKCSIRSSNYVSSLEILRTQVVDCGEYTCKASNEY
GSVSCTATLTVTEAYPPTFLSRPKALTTFVGKAAKFLCTVSGTPVIEIIWQKDGAALSPS
PDCRVTDADNKHSLELSNLTVQDRGIYSCKASNKFGADICQAELTIIDKPHFIKELEAVQ
SAINKKIHLECQVDEDRKVTITWSKDGQKLPAGKDYKIYFEDKIASLEIPLAKLKDSGTY
TCTASNEAGSSSSSAAVAVREPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKN
NKELSESNTVRMSFVNSEAILDITDVKVDDSGTYSCEATNDVGSDSCSTEVVIKEPPSFI
KTLEPADIVRGANALLQCEIAGTGPFEVNWFKDKKQIRSSKKYRLFTQKTFVYLEISSFN
SADVGDYECVVANEVGKCGCVATHLLKEPPTFVKKVDDFTALAGQTVTLQAAVRGSEPIS
VMWMKGQEVIKEDGKIKMSFSNGVAVLTIPDVQISLGGKYTCLAENEAGSQTSVGELIVK
EPAKIIERAELIQVTAGDPATLEYTVSGTPELKPKWYKDGRPLVASKKYRISFKNNIAQL
KFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPLFTKPLRNVDSVVGGACRLDC
KIAGSLPMRVSWFKDGKELTASDRYQIAFVEGTASLEISRVDMNDAGNFTCRATNSVGSK
DSSGALIVQEPPSFVTKPGSRDVLPGSAVCLKSAFQGSAPLTIKWFKGDKELVSGGSCYI
TKETSESSLELYAVKTSDSGTYTCKVSNVAGSVECSADLFVKEPATFIEKLEPSQLLKKG
DGTQLACKVTGTPPIKITWFANDRELRESSKHKMSFAESTAVLRLTDVAIEDSGEYMCEA
QNEAGSDHCTGIVIVKESPYFTKEFKSIEVLKEYDVMLLAEVAGTPPFEITWFKDNTTLR
SGRKYKTFLQDQLVSLQVLKFVAADAGEYQCRVTNEVGSSTCSARVTLREPPSFIKKIEA
TSSLRGGTAAFQATLKGSLPITVTWLKDNDEITEDDNIRMTFENNVASLYLSGIEVKHDG
KYVCQAKNDAGIQRCSALLSVKEPATIMEEAVSIDVTQGDPATLQVKFSGTKEISAKWFK
DGQELTLGPKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKASINVLDLIIP
PSFTKKLRKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASDKHKFSFHDNTAFLEI
SQLEGTDSGTYTCSATNKAGHSQCSGHLTVKEPPYFVEKPQSQDVNPGTRVQLKALVGGT
APMTIKWFKDNKELHPGAARSVWKDDTSTILELFSAKAADSGTYICQLSNDVGTTSSKAT
IFVKEPPQFIKKPSPVLVLRNGQSTTFECQVTGTPEIRVSWYLDGNEITDLRKYGISFVD
GLATFQISNARVENSGTYVCEARNDAGTASCSIELKVKEPPIFIRELEPVEVVKDSDVEL
ECEVMGTTPFEVTWLKNNKEIRSGKKYTMSEKMSVFYLHITKCDPSDVGEYQCIIANEGG
SCACSARVALKEPPSFIKKIENVTTVLKSSATFQSTVAGSPPISITWLKDDQILEENDNV
HISFEDSVATLQVRSVDNGHSGRYTCQAKNESGIERCYAFLLVQEPAQIIEKAKSVDVTE
KDPVTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFK
VENDFGSSSCDAYLRVLDQDIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDG
KEISTSAKYRLVCHENTVSLEVSNLELEDTANYTCKVSNVAGDNACSGILTVKEPPSFLV
KPERQQAIPDSTVEFKAVLKGTPPFKIKWLKDDVELVSGPKCFIGLEGSTSFLNLYSVDS
SKTGQYTCQVTNDVEPPKFVKKLEASKIIKAGDSARLECKITGSPEIQVVWYRNEHELTA
SDKYQMTFIDSVAVIQMNSLGTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIV
ETLKNTEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKVASKNFHASIHILNVESTDIGE
YHCKAQNEVGSDACVCAVKLKEPPKFISKLNSLTVVAGEPAELQASIEGAQPISVQWLKE
KEEVIRESENIRISFVNNVATLQFAKVEPANAGKYICQVKNDGGVRENMATLTVLEPAVI
IEKAGSMTVTVGETCALECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLKILSV
EKEDAGTYTFQVQNNVGKSSCTAVVDVSDRMVPPSFTRRLKDTGGVLGTSCILECKVAGS
SPISIAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGSYTCVAANVAGSDECRAL
LTVQEPPSFVKEPEPLEVLPGKNITFTSVIRGTPPFKVGWFRGARELVKGNRCNIYFEDT
VAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPATFVKKLSDHSVEPGKSIILE
GTYTGTLPISVTWKKDGVSITPSERCNIVTTEKTCILEILSSTKGDAGHYSCEIENEAGR
DACDALVSTLEPPYFVTELEPLEASVGDSVSLQCQVAGTPEITVSWFKGDTKLRSTPEYR
TYFTNNVATLVFNKVSINDSGEYTCMAENSIGTAASKTIFRIQERQLPPSFARQLKDIEQ
TVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQMSFVDNVATLKILQTDLSHSGQYS
CSASNPLGTASSTARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRVTWSK
DNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKF
IKKLDASKVAKQGESIQLECKISGSPEIKVVWFRNDSELHESWKYNMSFVNSVALLTINE
ASAEDTGDYICEAHNGVGDASCSTALKVKAPPVFTQKPPPVGALKGSDVILQCEISGTPP
FEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVGSDTCACTVK
FKEPPRFVKKLSDASTLIGDPVELQAVVEGFQPISVVWLKDKGEVIRESENVRISFVDNI
ATLQLGSPEASQSGKYVCQIKNDAGMRECSAVLTVLEPATIVEKPEPMTVTTGNPFTLEC
VVAGTPELSAKWFKDGRELSSGSRHHITFVRNLASLKIPSAEMNDKGLYTFEVENRVGKS
SCTVSVHVSDRVVPPSFVRRLKDTSATLGASVVLECRVSGSAPISVGWFLDGNEIISSPK
CQSSFADNVCTLTLSSLEPSDTGAYTCVAANVAGQDESSAVLTVQEPPSFEQTPDSVEVL
PGMSLTFTSVIRGTPPFKVKWFKGSRELVSGEACTISLEDFVTELELLEVEPGQSGDYSC
LVTNDAGSASCTTHLFVKEPATFVKRLADTSVETGSPIVLEATYSGTPPISVSWMKNEYP
LSQSPNCGITTTEKSSILEILESTIEDYAQYACLIENEAGQDICEALVSVLEPPYFIEPL
EHVEAAIGEPITLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSD
VGEYTCKAENSVGAVASSAVLVIKERKLPPSFARKLKDVHETLGFPVAFECRINGSEPLQ
VSWYKDGELLKDDANLQMSFVHHVATLQILQTDQSHVGQYNCSASNPLGTASSSAKLILS
EHEVPPFFDLKPVSVDLALGESGSFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENT
ATLTVLKVAKGDAGQYTCYASNVAGKDSCSAQLGVQEPPRFIKKLDQSRIVKQDEYTRYE
CKIGGSPEIKVLWYKDEVEIQESSKFRMSFEDSVAILEMHSLSVEDSGDYTCEARNAAGS
ASSSTSLKVKEPPVFRKKPFPVETLKGADVHLECELQGTPPFQVSWHKDKRELRSGKKYK
IMSENLLTSIHILNVDTADIGEYQCKATNDVGSDTCVGSVTMKAPPQFVKKLTDISTIIG
KEVQLQTTIEGAEPISVAWFKDKGEIVRESDNIWISYSENIATLQFSRAEPANAGKYTCQ
IKNDAGMQECYATLSVLEPAAIVEKPESIKVTTGDTCTLECTVSGTPELSTKWFKDGKEL
TSDNKYKISFFNKVSGLKIINVVPGDSGVYSFEVQNPVGKDSCKVSIQVSDRIIPPSFTR
KLKETNGLSGSSVVMECKVYGSPPISVLWFHDGNEISSGRKYQTTLTDNTCALTVNMLEE
ADAGDYTCIATNVAGSDECSAPLTVREPPSFVQKPDPMDVLTGSNVTFTSIVKGSPPFTV
SWFKGSTELVPGARCNVSLQDSVGELELFDVDTSQSGEYTCIVSNEAGRASCTTRLFVKA
PAIFVKRLNDYSIEKGKPLILEGTFSGTPPISVTWKKNGINVIASQRCNITTTEKSAILE
ILSSTVEDSGQYNCYIENASGKDSCSAQILILEPPYFVKQLEPVKVTVGDSASLQCQLAG
TPEIGVSWYKGDTKLRPTATCKMHFKNNVATLVFTQVDSSDSGEYICRAENSVGEVSSST
FLTVQEQKLPPSFSRQLRDVQETVGLPVVFECAVSGSEPISVSWYKDGKPLKDSPNIQTS
FLDNIATLNIFKTDRSLSGQYSCTATNPIGSASSGAKLILTEGKNPPFFDIPLAPMDAVV
GESADLECHVTGTQPIKVTWAKDNREIRSGGNYQISYLENSAHLTIVKVDKGDSGQYTCY
AVNEVGKDSCTAQLNIKERLIPPSFTKKLSETVEETEGNSFKLEGRVAGSQPITVAWYKN
NVEIHPTSNCEIMFKNNALLLQVKRASMADAGLYTCKATNDAGSALCTSSIVIKEPKKPP
VFDQHLAPVTASEGDSVQLSCHVQGSEPIRIQWLKAGREVKPSDRCSFSFASGTAMLELK
ETAKADSGDYVCKASNVAGSDTSKCKVTIKEKPAAAPAAKKAAVDGKLFFVSEPQSIRVV
EKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRILIHQKGDEAKLEIRDTTKTDSGLYR
CVAFNKHGEIESNVNLQVDERKKQEKIEGDLRAMLKKTPALKKGSGEEEEIDIMELLKNV
DPKEYEKYARMYGITDFRGLLQAFELLKQSQEEETHRLEIEELEKSERDEKEFEELVAFI
QQRLTQTEPVTLIKDIENQTVLKDNDAIFEIDIKINYPEIKLSWYKGTEKLEPSNKYEIS
IDGDRHTLRVKNCQPKDQGNYRLVCGPHIASAKLTVIEPAWERHLQDVTLKEGQTCTMTC
QFSVPNVKSEWFRNGRVLKPQGRVKTEVEHKVHKLTIADVRAEDQGQYTCKHEDLETSAE
LRIEAEPIQFTKRIQNIVVSEHQSATFECEVSFDDAIVTWYKGPTELTESQKYNFRNDGR
CHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAELYLTTKEIKLEMKPPDIPDSRVPIPT
MPIRAVPPEEIPPAVAPSIPLLLPLPEEKKPPAKRIEVTKKGVKKDTKKVVTKPKEEAPP
PPVPEVAKKPPPPTPMIPAKASEIIDVSSKAEEVKITTITRKKEVHKEKEAVYEREEAVY
EKKVHIEPWEEPYEELETEPYTEPYEEPYYEEPDEDYEEIKVEAKKQVHEEWEEDFEEGQ
EYYEREEGYDEGEEEWEEIYHEREIIQVQKEVHEELHEKKIPAKVPEKKVPPPKVVKKPV
VEKVEKTTRRMEEEKVQVIKVPEVSKKIVPQKPSRTPVQEEIIEVKVPAVHTKKMVISEE
KMFFASHTEEEVSVSVPEVQKKTVTEEKIHVAVSKKIEPPPKVPEPPKKPVPEEVVPVPI
PKKVEPPAAKVPEAPKKPVPEEKKPVPIPKKKEPAAPPQVPEAPKKPAPEEKIPVPVTKK
KEAPPAKVPEVQKKVVTEEKIAIITQREESPPPAVPEIPKKKVPEEKRPVPRKEEVPPPK
VPVPPKKAVPEAVVPAPIPKKAPPRAEVSKKTVVEEKRFAAEEKLSVAVPQRVELMRHEE
EEWTYSEEEERVSVSVYREEERDEEEAEITEYEVLEEPEEYVVEEKMHFISKKVEVEPAK
VPEKKIIPKPKVPAKIEEPPPTKVPEPPKKIVPEKKVPAPAPKKVPPAKAPEESKRPVPE
KRAPAEEVGIEEPPPTKVAERHMKITQEEKVLVAVTKKEAPPRARVPEEPKKVAPEERFP
KLKPRREEEPPAKVTEVRKRAVKEEKVSIEVPKREPRPTKEVTVTEEKKWSYTREEETVS
EHREEEYEDYEDYEEYKEFEEYEPTEEYDQYDEYAEREVEHYEEHEEYVTEPKKPVPVKP
AQEPVPAKPKAPPPKVLKKAVPEEKAPLPIQKKLKPLPPKAPEEPKKVVEEKIQISITKR
EKQQVTEPVAKVPMKPKRVVPEAKIPAPTKEVAVPVRESLSFVICGSVLLKCLNFIEELE
NSQLKDDIFKVPGVPKKRELEEVVVFKEEVEAHEEYIVEEEEEYVHEEEYVHKEEYVHEE
EYVHKEEYIHEEEEHLHEEEETIAEEEVVPVAPVKVPVVPKKPVPEEKKPVPVPKKKEAP
PAKVPEIPKKPEEKVPVPIPKKEKAPPAKVPEVPKKPVPEEKPPVPVPKKVEPPPAKVPE
VPKKPVPEKKVPAPTPKKVEAPPAKVPEVPKKPIPEEKKPTALLKKMEAPPPKAPKKREV
VPVPVALPREEEEEEVPFEEVPEEEILPEEEVPSEEEAPPEEVPPEEEEVLPEEEEVLPE
EEEVLPEEEEVQPEEEALPEIKPKVPKPAPVPEIKKKVPEKKVVVPKKEEAPPTKVPEVS
KKVEERRIIPPKEEEVPPAEVYEEAEEPTPEEIPEEPPSIEEEEIVEEEEEEEEVLPPRA
PEVVKKAVPEAPTPVPKKAEAPPAKVPKKIPEEKVPVPVQKKEAPPAKVPEVPKKVPEKK
KIPEKKVPVPKKEAVPPAKGKAVFEEKISVAYQQEELVQERIELELVEAKVEEAFEEEEF
HEVQEYFEEEEFHEVEEFIRVEERRFQEEHKVEEVHRVIEFLEAEEVEVYEKPKIPPKKG
PEVSEKVIPPKKPPTKVIPRKEPPAKVPEVTKKTVVEEKIRAPEEPKVPAPKEVVPEKKV
SVVPPKKPEAPPAKVPEAPKEAAPEKKVPVAPKKKPEAPPVKVPEVPKTAVPQKKIPEAI
PPKPESPPLEVPEAPKEVVPEKKVSVVPPKKPEAPPAKVPEAPKEAAPEKKVPVAPKKKP
EAPPVKVPEVPKAAVPQKKIPEAIPPKPESPPPEVYEEPEEEIVPEEPPEEAVEEPVPAP
PPKVTEPPKKPVPEKKAPPAVVKKPEPPPAKVPEVPKEAPPEKKVPPKKPEAPPAKVPEV
PKEVVTEKKVAVPKKPEVPPAKVPEVPKKPVIEEKPAIPVVEKVASPPAEVYEEPEEVTA
EEEEPAPAVEEEEYEAPPPPAPVPEEPKKVVPEKKFPVIKKPEAPPPKEPEPEKKVIEKP
KLKPRPPARPPSPPKEDVKEKMFQLKAVSKKKVPEKPEVVEKVEPAPLKVPTAEKKVRKL
LPEPKPQPKEEVVLKSVLRKKPEEEEPKVEPKKVEKAKKPEEPQPPPKAVEVEAPPEPTP
KERKVPEPAKVPEIKPAIPLPGPEPKPKPEPEVKTMKAPPIEPAPTPIAAPVTAPVVGKK
AEAKPKDEAAKPKGPIKGVAKKTPSPIEAERKKLRPGSGGEKPPDEAPFTYQLKAVPLKF
VKEIKDIVLTEAESVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHI
IDVQLSDAGEYTCVLRLGNKEKTSTAKLIVEELPVRFVKTLEEEVTVVKGQPLYLSCELN
KERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSC
VKVVEIIREWLVKPIRDQHVKPKGTAVFTCDIAKDTPNIKWFKGYDEIPLEPNDKTEILK
EGNHLFLKVKNAMPEDIDEYAVEIEGKRYPAKLTLGEREVELLKPIEDVTIYEKESASFD
AEISEEDIPGEWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQACNAITTA
ILTVKEIELDFAVPLKDVTVPEKRQARFECVLTREANVIWSKGPDIIKASDKFDIIADGK
KHILVINDSQFDDEGVYTAEVEGKKTSAQLFVTGIRLKFISPLEDQTVKEGQTATFVCEL
SHEKMHVVWFKNDVKLHTTRTVLMSSEGKTYKLEIRETTLDDISQIKAQVKNLSSTANLK
VLEADPYFTVKLHDKTGVEKDEIILKCEVSKDVPVKWFKDGEEIVPSPKHSVKTDGLRRI
LKIKKAELKDKGEYVCDCGTDTTKANVTVEARLIKVEKPLYGVEVFVGETARFEIELSEP
DVHGQWKLKGEPLTASPDCEIIEDGKKHVLVLYNCQLDMTGEISFQAANAKSAANLKVKE
LPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTRHSLV
IKSAAFEDEAKYMFEAEDKRTSGKLIIEGIRLKFLTPLKDVTAKERENAVFTVELSHDNI
PVSWFKNDQRLHTSKRVSMHDEGKTHSITFKDLSIDDTSQIRVEAMGISSEAKLTVLEGD
PYFTGKLQDYTGVEKDEVILQCEISKADAPVKWFKDGKEIKPSKNVVIKADGKKRMLILK
KALKSDIGQYTCDCGTDQTSGKLDIEDREIKLVRPLYSVEVMETETARFETEISEDDIHA
NWKLKGEALLQTPECEIKEEGKIHVLILHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIG
LLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEPNDKVVTRSEGRVHTLTLRDV
KLEDAGEVQLTAKDFKTQANLFVKEPPVEFTKPLEDQTVEEEATAVLECEVSRENAKVKW
FKNGTEILKSKKYEIVADGRVRKLIIHGCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFL
RPLTDLQVKEKETARFECEISKENEKVQWFKDGAEIKKGKKYDIISKGAVRILVINKCLL
NDEAEYSCEVRTARTSGMLTVLEEEAVFTKNLANLEVSEGDTIKLVCEVSKPGAEVIWYK
GDEEIIETGRFEILTDGRKRILIIQNAQLEDAGSYNCRLPSSRTDSKVKVHELAAEFISK
PQNLEILEGEKAEFVCTISKESFEVQWKRDDQTLESGDKYDIIADGKKRVLVVKDATLQD
MGTYVVMVGAARAAAHLTVIEKLRIIVPLKDTKVKEQQEVVFNCEVNTEGAKAKWFRNEE
AIFDSSKYIILQKDLVYTLRIRDARLDDQANFNVSLTNHRGENVKSAANLIVEEEDLRIV
EPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEEVAFDNRISYRIDKYKHSLIIKDCGF
PDEGEYVVTAGQDKSVAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYR
NGREIKEGKKYKFEKDGSIHRLIIKDCRLEDECEYACGVEDRKSRARLFVEEIPVEIIRP
PQDILEAPGADVIFLAELNKDKVEVQWLRNNMIVVQGDKHQMMSEGKIHRLQICDIKPRD
QGEYRFIAKDKEARAKLELAAAPKIKTADQDLVVDAGQPLTMVVPYDAYPKAEAEWFKEN
EPLSTKTVDTTAEQTSFRISEAKKDDKGRYKIVLQNKHGKAEGFINLQVIDVPGPVRNLE
VTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLVTDRADSCEFTVTGLQKGG
VEYLFRVSARNRVGTGEPVETDSPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYD
GGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPS
AATPFVKVADPIERPSPPVNLNASEQTQSSVQLTWEPPLKDGGSPILGYIIERREEGKDN
WIRCNMKPVPELTYKVTGLQKGNKYLYRVSAENAAGVSDPSEILGPLTADDAFVEPTMDL
SAFKDGLEVIVPNPIKILVPSTGYPRPKATWTFGDQVLEEGDRVKMKTISAYAELVISPS
ERTDKGIYTLTLENPVKSISGEINVNVIAPPSAPKELKFSDITKDSVHLTWEPPDDDGGS
PLTGYVVEKRDMSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYTDE
PVNMSAPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVEKCPRGSDKWVAC
GEPVPDTKMEVTGLEEGKWYAYRVKALNRQGASKPSKPTEEIQAVDTQEAPEIFLDVKLL
AGITVKAGTKIELPATVTGKPEPKITWTKADTLLKPDQRITIENVPKKSTVTITDSKRSD
TGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITN
YVVERKATDSDVWHKLSSTVKDTNFKATKLTPNKEYIFRVAAENMYGVGEPVQAAPIIAK
YQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPV
KDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSRSTEPILIKDPIDPPWPPGKPTVKDIGK
TSLVLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEGVPTTEHLLTGLMEGQEYSFRV
RAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITN
YIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIGDSVLA
KDTFTTPGPPYALTVVDVTKRHVDLKWEPPKNDGGRPIQRYIIEKKEKLGTRWVKAGKTS
GPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAG
RKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGIVPDKEYV
LRVRAVNAVGVSEPSEISENVVAKDPDCKPTIDLETHDIVVIEGEKLNIPVPFRAVPVPT
VSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVHADAGVYTITLENKLGSATASINVKVI
GLPGPCKDIKASDITKSSCKLTWEPPEFDGGSPILHYVLERREAGRRTYIPVMSGENKLS
WTVKDLIPNGEYFFRVKAVNKIGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAKAMT
ITWKPPLYDGGSKIMGYIIEKITKGEDRWKRCNEHLVPVLTYTAKGLEEGKEYQFRVRAE
NAAGIGEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEIALDATISGSPYPTITWIKDE
NVIVPEEIKKRAAPPVRRKKGEAEEEEPFSLPLTERLSINNSKQGESQLRIRDSLRPDHG
QYMIKVENDHGVAKAPCSVSVLDTPGPPINFVFEDIRKDSVLCKWEPPLDDGGSEIINYT
LEKKDKTKPDSDWIVITSTLRNCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLLAK
DPFEPPDAPDKPIVEDVTSNSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKTLLS
SLKTKVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTARDPISPPGPPVPRVADTSSTT
IELEWEPPAFNGGGEIMGYFVDKQLVGTNEWSRCTEKMIKVRQFTVKEIREGADYKLRVS
AVNAAGEGPPGETEPVTVAEPQEPPTVELDVSVKGGIQIMAGKTLRIPAEVTGRPVPTKV
WTIEEGELDKERVIIENVGTKSELIIKNALRKDHGRYVITATNSCGSKFAAVRVEVFDVP
GPVLDLKPVVTNRKMCLLNWSDPADDGGSDITGFIIERKDAKMHTWRQPIETERSKCDIT
GLIEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKE
PRSDGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNDVGE
SEPSLPLNVVIQDDEVPPTIKLRLAVRGDTIKVKAGEPVNIPADVTGLPMPKIEWSKNEK
VIDKPTDTLNITKEEVSRSEAKTELSIPKAAREDKGTYTITASNRLGSVFRNVHVEVYDR
PSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYIIDKRDASRKKSEWEEVTNTAVERR
YGIWKLIPNGQYEFRVRAVNKYGISDECKSDKVVIQDPYRLPGPPGKPKVLERTKGSMLV
SWTPPLDNGGSPITGYWLEKREEGGTYWSRVSRAPITKVGLKGVEFNVPRLIEGVKYQFR
AMAINAAGIGPPSEPSDPAVAGDPIYPPGPPSCPEVKDKTKSSISLAWKPPAKDGGSPIK
GYIVEMQEEGTTDWKPVNEPDKLLTACECVVPNLKELRKYRFRVKAVNEAGESEPSDTTG
EIPATDIQEVPEVFIDIGAQDCLVCKAGSQVKIPAVIKGRPTPKSSWEFDGKAKKAMKDG
VHDIPEDAQLETAENSSVIIIPECTRAHSGKYSITAKNKAGQKTANCRVKVMDAPGPPKD
LKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKKTIDGKAWTKVNPNCGSTTFVVPDLIS
EQQYFFRVRAENRFGIGPPAETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKN
DGGSPVTHYIVECLAWDPTGKKKEAWRQCNRRDVEELEFTVEDLIEGGEYEFRVKAVNEA
GVSKPSATVGPVIVKDQTCPPAIELKEFMEVEEGTDVNIVAKIKGVPFPTLTWFKAPPKK
PDSKEPVVYDTHVNKQVVDDTCTLVIPQSRRSDTGLYSITAVNNLGTASKEMRLNVLGRP
GPPVGPIKFESISADQMTLSWLPPKDDGGSKITNYVIEKREANRKTWVRVSSEPKECMYT
IPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNW
EEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYA
INAAGVGPASLPSDPVTARDPVAPPGPPFPKVTDWTKSSVDLEWSPPLKDGGSKITGYIV
EYKEEGKEEWEKGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNVAGVGEPGEVTDVIEMKD
RIVSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWSMNERALPQEAAIETTAIS
SSMVIKNCQRSHQGVYSLLAKNEGGERKKTIIVDVLDVPGPVGIPFLSDNLTNDSCKLTW
FSPEDDGGSPITNYVIQKREADRRAWTPVTYTVTRQNATVQGLIQGKSYFFRIAAENSIG
MGPFVETPNALVIRDPITVPERPEDLEVKEVTKNTVSLTWNPPKYDGGSEIINYVLESRL
IGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAP
PTLDLDFRDKLTVRVGESFALTGRYSGKPKPKIDWFKDEADVLEDDRTHIKTTPTTLALE
KTKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVIFDEVTKEYMVISWKPPL
DDGGSEITNYIIEKKELGKDIWMPVTSASAKTTCKVPKLLEGKDYIFRIHAENLYGISDP
LVSDSMKAKDRFRVPDAPEQPVVTEVTKDSALVTWNKPNDGGKPITNYILEKRETMSKRW
VRVTKEPIHPYTKYRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFARDPIAKPSPPI
NPEAIDTTCNSVELTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVT
GLRDGQSYKFRVLAVNEAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIRVGDTLR
LSAIIKGVPFPKVTWKKEDREAPTKAQIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGT
KTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVVTNYVVERKDVATAQWS
PLSTTSKKKSHMAKHLTEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPGPPKDLH
HVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGDKDWIKFKTVKNLDCVVTGLQQGKT
YRFRVKAENIIGLGLPDTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGV
PVPTAKWTTDGTEIKTDDHYTVETDSFSSVLTIKNCLRKDTGEYQLTVSNAAGTKTVAVH
LTVLDVPGPPTGPINILDVTPEYMTISWQPPKDDGGSPVINYIVEKQDTRKGTWGVVSAG
SSKLKLKVPHLQKGCEYVFRVKAENKMGVGPPLDSIPTVAKHKFSPPSPPGKPVVTDITE
NAATVSWTLPKSDGGSPITGYYVERREITGKWVRVNKTPIADLKFRVTGLYEGNTYEFRV
FAENLAGLSNPSPSSDPIKACRPIKPPGPPINPKLKDKSKESADLVWTKPLSDGGSPILG
YVVEYQKPGTAQWDRINKDELIRQCAFRVPGLIEGNEYRFRIRAANIVGEGEPRELAESV
IAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWSKEGKVLVKDKRVDL
IHDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVSNVTKEN
CTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLVKANLLANNEYYFRVCAE
NKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHV
ERRLKGSADWERVHKGSIKETHYMVDKCVENQIYEFRVQTKNEGGESDWVRTEEVVVKED
LQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTSAE
SSKFSLTKAKRSDGGKYVITATNPAGSFVAYATVNVLDKPGPVRNLKITDVSSDRCTIRW
DPPEDDGGCEIQNYILEKCESKRMVWSTYSANVLTPSATVTRLIEGNEYIFRVRAENKIG
TGPPTESKPVIAKTKYDRPGRPDPPEVTKVSKEEMTVVWNAPEYDGGKSITGYYLEKKEK
HAVRWVPVNKSAIPERRLKVQNLLPGHEYQFRVKAENEVGIGEPSLPSRPVVAKDPIEPP
GPPTNFKVVDTTKSSITLAWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQL
IRMEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDASMRKLVV
VRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYS
LTLVNPAGEKAVFVNVKVLDTPGPVADLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEK
REAERKTWSTVTPEVKKTSFNVTNLVPGNEYFFRVTAVNEYGPGVPTDIPKPVLASDPLS
EPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYIISYREEDQPADRWTEYSVVKDLS
LIVTGLKEGKKYKFRVAARNAVGVSMPREAEGVYEAKEQLLPPKILMPEQITIKAGKKLR
VEAHVYGKPNPICKWKKGDDEVVTSSHLAIHKADGSSVLIIKDVTRKDSGYYSLTAENSS
GSDTQKIKVTVMDAPGPPQPPFDISEIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRG
DWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEPLTSPKMLAKFPFDVPSEPKN
ARVTKVNKDCIFVAWDRPDSDGGSPITGYLIERKERNSLLWVKANDTIVRSTEYPCAGLV
EGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPGKPEVVDVTKNSASLIWARPKHDG
GSRIIGYFVEACKLPGDKWVRCNTTPHQIPQEEYTATGLEENAQYQFRAIAKTAVNISQP
SEPSDPVTILAENVPPRIELSVEMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDTTPIK
QAEGIKMAMKRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKI
NKMYADRAMLSWEPPLEDGGSEITNYIIDKRETSRPNWAQVSATVPITSCTVEKLIEGHE
YQFRICAENKYGVGDPILTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKAPADDGGS
PITGYLVEKRETQAVNWTKVNRKPVIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDAS
KAVYAQDPLYPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDHWVR
CNLPEKLQKTRFEVTGLMENTEYQFRVYAVNKIGYSDPSDVPDKHCPKDILIPPEGELDA
ELRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRERIGLDIKSTDFDTFLRCENVN
KYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEVSKDSAYVTWDPPIIDGGSP
IINYVVEKRDAERKSWSTVTTECSKTSFRVSNLEEGKSYFFRVFAENEYGIGDPGETRDA
VKASETPGPVVDLKALAITKSSCTIGWKKPRSDGGSRITGYVVDFLTEENKWQRVMKSLS
LQYSTKDLKEGKEYTFRVSAENENGEGTPSEIVVVAKDDVVAPDLDLKDLPDLCYLAKEN
SNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESTAVNTTLVVYDCQKSDAGKYTITL
KNVAGTKEGTLSIKVVGKPGIPTGPIKFDEVTAEAMTLKWGPPKDDGGSEITNYVLEKRD
SVNNKWVTCASAVQKTTFRVTRLHEGIEYTFRVSAENKYGVGEGLKSEPIVAKHPFDVPD
APPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHIEFKERNSLLWKRANKTPIRMKDFKV
TGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVISVTRNSVTLIWTEP
KYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPDCAFTVTDLVEGGKYEFRIRAKNTAGAI
SAPSESTGTIICKDEYEAPTIVLDPTIKDGLTVKAGDSIVLSAISILGKPLPKSSWSRAG
KDIRPSDIAQITSTPTSSMLTVKYATRKDAGEYTITATNPFGTKEEHVKVSVLDVPGPPG
PIEISNVSAEKATLTWTPPLEDGGSPIKAYVLEKRETSRLLWTVVSEDIQACRHVVTKLI
QGNEYLFRVSAVNHYGKGEPVQSEPVKMVDRFGPPGPPGKPEISNVTKNTATVSWKRPTD
DGGSEITGYHVERREKKGLRWVRATKTPVSDLRCKVTGLQEGNTYEFRVSAENRAGIGPP
SDASNPVLMKDVAYPPGPPSNAHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDD
AWIKDTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPNVEIVEKEVAPDFE
LDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKHRANIENTESFTLLIIPEC
NRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGS
RITNYIVEKREATRKSYSTVTTKCHKCTYKVTGLTEGCEYFFRVMAENEYGVGEPTETTE
PVRASEAPLPPDSLNIMDITKNTVSLAWPKPRHDGGSKITGYVIEAQRKGSDQWTHISTV
KGLECVVRNLTEGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELDLRGIYQKLVIA
RAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNVENTATSTILNINECVRSDSGPYP
LTAKNTVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWEPPENDGGVPISNYVVE
MRQTDSTTWVELATTVIRTTYKATRLTTGVEYQFRVRAQNRYGVGPGITSASVVANYPFK
VPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHIERKERNGILWQTVSKALVPGNI
FKSTGLTDGIAYEFRVIAENMAGKSKPSKPSEPMFALDPIDPPGKPVPLNITRHTVALKW
AKPEYTGGFKITSYVVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAA
GAISPPSEPSDAITCRDDLEAPRIMVDVRFKDTITLKAGEAFKLEADVSGRPPPTMEWTK
DGKELEGTGKLEIKIADFSTHLINKDSSRTDSGAYILTATNPGGFAKHIFNVKVLDRPGP
PEGPLAVSDVTSEKCVLSWLPPLDDGGAKIDHYIVQKRETSRLAWTNVATEVQVTKLKVT
KLLKGNEYIFRVMAVNKYGVGEPLESEPVLAVDPYGPPDPPKNPEVTTITKDSMVVCWGH
PDSDGGSEIINYIVERRDKAGQRWVKCNKKALTDLRFKVSGLTEGHEYEFRIMAENAAGI
SAPSATSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALP
EEDEWQVVTPPAGLKATSYTITSLIENQEYKIRIYAMNSEGLGEPALVPGTPKAEERMLP
PEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWAREHGESLDKASIESTSSYTLLV
VGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQNLKIKEVTKTSVTLTWEPPLL
DGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPA
ETAESVKASERPLPPGKITLTDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDRWAT
CATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTF
TVLAGEDLKIDVPFIGRPPPAVTWHKDDIPLKQTTRVNAESTENNSLLTIKEACREDVGH
YTVKLTNSAGEATETLNVIVLDKPGPPTGPVKMDEVTADSVTLSWEPPKYDGGSSINNYI
VEKRDTSTTAWQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPVVAQYP
FKVPGPPGTPFVTLASKDSMEVQWHEPVSDGGSKVIGYHLERKERNSILWVKLNKTPIPQ
TKFKTTGLEEGIEYEFRVSAENIVGIGKPSKPSECYAAHDPCDPPGRPEAIIVTRNSVTL
QWKKPTYDGGSKITGYIVEKKELPDGRWMKASFTNIIDTQFEVTGLLEDHRYEFRVIARN
AAGVFSEPSESTGAITARDEVEPPRISMDPKYRDTVVVQAGESFKIDADIYGKPIPTTQW
VKGDQELSSTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGEKSVTINVKVLDRP
GPPEGPVAISGVTAEKCTLAWKPPLQDGGSDITNYIVERRETSRLVWTLVDANVQTLSCK
VLKLLEGNEYIFRIMAVNKYGVGEPLESESLIAKNPFVVPDAPKAPEVTAVTKDSMIVVW
ERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLLENHNYEFRVSAENAA
GLSEPSPPSAYQKACDPIYKPGPPNNPKVMDVTRSSVFLSWTKPIYDGGCEIQGYIVEKC
DVSVGEWTMCTPPTGINKTNLEVEKLLEKHEYNFRICAINKAGVGEHADVPGPVMVEEKL
EAPDIDLDLELRKVINIRAGGSLRLFVPIKGRPTPEVKWGKVDGDIRDAAIIDVTSSFTS
LVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPP
LLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGL
PARTADPIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKNTDKW
SECARVKSLDAVITNLTQGEEYLFRVIAVNEKGRSDPRSLAVPIIAKDLVIEPDVRPAFS
SYSVQVGQDLKIEVPISGRPKPSISWTKDGMPLKQTTRINVTDSLDLTTLSIKETHKDDG
GQYGITVSNVVGQKTAAIEIITLDKPDPPKGPVKFDEISAESITLSWNPPLYTGGCQITN
YIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESEPVVAQ
YPYKEPGPPGTPFVTAISKESMVVQWHEPINNGGSPVIGYHLERKERNSILWTKVNKTII
HDTQFKALNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEAIIVKRNEI
TLQWTKPVYDGGSMITGYIVEKRDLPEGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIA
KNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTI
EWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLD
RPGPPEGPVQVTGVTAEKCTLAWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNS
LKVTKLLEGNKYIFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTV
CWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAEN
AAGVGEPSPATVYYKACDPVFKPGPPTNAHVVDTTKNSITLAWSKPIYDGGSEILGYVVE
ICKADEEEWQIVTPQTGLRVTRFEIAKLIEHQEYKIRVCALNKVGLGEAASVPGTVKPED
KLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSKEEGEFTDKVQIEKGINF
TQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSVLLVWE
PPIIDGGAKVKNYVIDKRESTRKAYANVSSKCNKTSFRVENLTEGAIYYFRVMAENEFGV
GVPTETSDAVKASEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRILGYVVEMQPKGTE
KWSVVAESKVCNAVVSGLSSGQEYQFRVKAYNEKGKSDPRVLGIPVIAKDLTIQPSFKLP
FNTYSVQAGEDLKIEIPVIGRPRPKISWVKDGEPLKQTTRVNVEETATSTILHIKESSKD
DFGKYSVTATNSAGTATENLSVIVLEKPGPPVGPVKFDEVSADFVVISWEPPAYTGGCQI
SNYIVEKRDTTTTNWQMVSATVARTTIKISKLKTGTEYQFRIFAENRYGKSTPLDSKPVV
VQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGSKVTGYHLEQKEKNSILWVKLNKI
PIQDTKFKTTGLDEGLEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIVITRN
SVTLKWKKPVYDGGSKITGYIVEKKDLPDGRWMKASFTNVVETEFTVTGLVEDQRYEFRV
IARNAADNFSEPSESSGAITARDEIDAPNASLDPKYRDVIIVHAGETFVLEADIRGKPIP
DIIWSKDGNELEETAARMEIKSTLQKTTLIVKDCIRTDGGQYTLKLSNVGGTKTIPITVK
VLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGASISHYIIEKRETSRLSWTQVSNEVQ
ALNYKVTKLLPGNEYIFRVMAVNKYGIGEALESEPVIACNPYKRPGPPSTPEASAITKDS
MVLTWTRPVDDGGAEIEGYILEKRDKEGIRWTKCNKKTLTDLRFRVTGLTEGHSYEFRVA
AENAAGVGEPSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWNKPIYDGGAPVRGY
VIELKKAAADEWTTCTPPSGLQGKQFTVTKLKENTEYNFRICAFNTEGVGEPATIPGSVV
AQERMEAPEIELDADLRKVVTLRASATLRLFVTIKGRPEPEVKWEKAEGILTERAQIEVT
SSYTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTL
SWEPPLIDGGAKITNYIVEKRETTRKAYATITNNCTKNTFKIENLQEGCSYYFRVLASNE
YGIGLPAETAEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTK
GSEKWSACTQVKTLETTISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIAKDIEIKPSV
ELPFNTFNVKANDQLKIDIPFKGRPQATVAWKKDGQVLRETTRVNVASSKTVTTLSIKEA
SREDVGTYELCVSNTAGSITVPITVIVLDRPGPPGPIRIDEVSCDNVSISWNPPEYDGGC
QISNYIVEKRETTSTTWQVVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSA
VVAEYPFSPPGPPGTPKVVHATKSTMVVSWQVPVNDGGSQVIGYHLEYKERSSILWSKAN
KVLIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKACEPVPARDPCDPPGQPEVTNIT
RKSVSLKWSKPRYDGGAKITGYIVERRELPDGRWLKCNFTNVQETYFEVTELTEDQRYEF
RVFARNAADSVSEPSESTGPITVKDDVEAPRIMMDVKFRDVIIVKAGEVLKINADIAGRP
LPVISWAKDGVEIEERAKTEIVSTDYTTTLTVKDCVRRDTGQYVLTLKNVAGTRTMAVNC
KVLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSRLAWTICEAEL
RTTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLESMAVKALDPFTTPSPPTSLEITSVTKD
SMTLCWSRPETDGGSDISGYIIERREKNSLRWMRVNKKPVYDLRVKSTGLREGCEYEYRV
FAENAAGLSLPSETSPLVRAEDPVFLPSPPSKPKIVDSGKTTITIGWVKPLFDGGAPITG
YTVEYKKSEETDWKVAIQSFRGTEYTMSGLTTGDEYVFRVRSLNKMGASDPSDSSDPQVA
KEREEEPVFDVDSEMRKTLIVKAGSSFTMTVPFRGRPIPNVSWSKPDTDLRTRAYIDSTD
SRTLLTIENANRNDSGKYTLTIQNVLSAASMTFVVKVLDSPGPPANITVREVTKETAMLS
WDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEF
GVGVPAETKEGVKITEKPSPPEKLGVTSVSKDSVSLSWLKPEHDGGSRIIHYVVEALEKG
QKTWVKCAVVKTTHHVVSGLRESHEYFFRVFAENQAGLSDPRELLLPVLIKDQLEPPEID
MKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLK
ESVTTDAGRYEITAANSSGTTKTFINIIVLDRPGPPTGPVAISDITEESVTLKWEPPKYD
GGSHVTNYIVLKRETSTAVWSEVSATVARTMIKVMKLTTGEEYQFRIKAENRFGISDHID
SVCVVVKLPYTTPGPPSTPWVSNVTRESITVGWHEPVSNGGSAVTGYHLEMKDRNSILWQ
KANKMIIRTTHFKVTTISAGLIYEFRVYAENAAGIGKPSHPSEPVLAIDACEPPRNVRIT
DISKNSVNLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVIETQFTVSGLTQNSQ
YEFRVFARNAVGSVSNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGIS
GKPEPTIEWYKDDKELQTNALVCVENSTDLASILIKDANRLNSGSYELKLRNAMGSASAT
IRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVA
ENLEECIVTTTKIIKGNEYVFRVRAVNKYGIGEPLESEPVVAKNAFVTPGPPSIPEVTKI
TKNSMTVVWDRPTVDGGSEINGYFLERRDKKSLAWLKVLKETIRDTRQKVTGLTENSDYQ
YRVCAVNAAGVGPFSEPSDFYKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSD
VTGYVVEMKQGDEEEWTIVSTRGEVRTTEYVVSNLKPGVNYYFQVSAVNCAGQGEPITMT
EPAQAKDVLEEPEIDLDVALRTSVIAKAGEDVQLLIPFKGRPPPTVTWRKDEKNLGSDTR
YSIQNTDSSSLLVIPQVTRNDTGKYILTIENGVGQPKSSTVSVKVLDTPAACQKLQVKHV
SLGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSGTSFKVTDLSEKTPFFF
RVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVVLSWTKPDFDGGSIITDY
LVERKGKGEQAWSHAGISKTCEIEIGQLKEQSVLEFRVSARNEKGQSDPVTIGPLTVKEL
VITPEVDLSEIPGAQISVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEYVRFSKTEN
KITLSIKNSKKEHGGKYTVILDNAVCRNSFPITIITLGPPSKPKGPIRFDEIKADSAIMS
WDIPEDDGGGEITCYSIEKREASQTNWKMVCSSVARTTFKVSNLVKDSEYQFRVRAENRY
GVSEPLASNIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKE
RNSILWQRVNTSPISGREYRATGLIEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVDP
PGTPDYIDVTRETITLKWNPPLRDGGSKIVAYSIEKRQGSDRWVRCNFTDVSECQYTVTG
LSPGDRYEFRIIARNAVGTISPPSQSSGLIMTRDENVPPTVEFGPEYFDGLVIKSGDSLR
IKALVQGRPVPRVTWFKDGVEIERRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNVS
GSTKAEVTVKVQDTPGKVVGPIRFTNITGEKMTLWWEAPLNDGCAPVTHYIIEKRETSRL
AWALIEDNCEALSYTAIKLITGNEYQFRISAVNKFGVGRPLESDPVVAQIQYTIPDAPGV
PEPSNVTGNSITLTWTRPESDGGSEIQHYILERREKKSTRWVKVISKRPISETRFKVTGL
VEGNEYEFHVMAENAAGIGPASGISRLIKCREPVNPPSAPSVVKVTDTSKTTVSLEWARP
VFDGGMEIIGYIIEMCKADLGDWHKVNTEPCVKTRYTVTDLQAGEEYKFRVSAVNGAGKG
DSCEVTGTIKAVDRLSAPELDIDANFKQTHIVRAGVSIRLFIAYQGRPTPTAVWSKPDSN
LSIRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGKKSITFTVKVLDSPGPPGPITF
KDVTRGSATLMWDAPLLDGGARIHHYVIEKREASRRSWQVVSEKCTRQILKVSELTEGVP
YYFRVSAENEYGVGEPYEMPEPIVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRI
TSYLLEMRQKGSDFWVEAGHTKQLTFTVERLVENTEYEFRVKAKNDAGYSEPREAFSSVI
IKEPQIEPTADLTGITNQLITCKAGSTFTIDVPISGRPAPKVTWKLEEMRLKETDRMSIA
TTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFTITVVVIGRPGPVTGPIEVSSVSAES
CVLSWTEPKDDGGTEITNYIVEKRESGTTAWQLINSSVKRTQIKVTHLTKYKEYCFRVSS
ENRFGVSKPLESVPIVAEHPFVPPSAPTRPEVYYVSANAMSIRWEEPYHDGGSKIVGYWV
EKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQN
PVDPPGRPEVTDVTRSTVSLIWSAPVYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVS
DNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLQGDLV
TIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKISLQYTGKRATAVIKYCDRSDSGK
YTLTVKNASGTKSVSVMVKVLDSPGPCGKLTVSRVTEEKCTLAWSLPQEDGGAEITHYIV
ERRETSRLNWVIVEGECLTASYVVTRLIKNNEYTFRVRAVNKYGLGVPVESEPIVARNSF
TIPSQPGIPEEVGAGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYD
TRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKRS
ISLAWTKPMYDGGTDIIGYVLEMQEKDTDQWCRVHTNATIRNNEFTVPDLKMGQKYSFRV
AAVNAKGMSDYSETTAEIEPVERLEIPDLELADDLKKTVIVRAGASLRLMVSVSGRPSPV
ITWSKKGIDLANRAIIDNTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDT
PGPCPSVSVKEVSRDSVTITWEIPTIDGGAPVNNYIIEKREAAMRAFKTVTTKCSKTLYR
ISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPLVPTKLEVVDVTKSTVTLAWEK
PLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVISLNEGEQYLFRVRAQNEKGV
SEPREIVTPVTVQDLRVLPTIDLSTMPQKTIHVPAGRPIELVIPITGRPPPTASWFFAGS
KLRESERVTVETHTKVTKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTG
PIKIDEIDATSVTISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRPTFKFTRLT
EGNEYVFRVAATNRFGIGSYLQSEVIECRSSISIPGPPETLQIFDVSRDGMTLTWYPPED
DGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLIEGLEYEHRVTAINARGTGKP
SRPSKPTVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQR
EWTKCNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYE
LDERYQEGVFVRQGGVIRLTIPIKGKPFPVCKWTKEGQDISKRAMIATSETHTELVIKEA
DRNDSGTYDLVLENKCGKKTVYIKVKVIGSPNTPEGPLEYDDIQARSVRVSWRPPADDGG
ADILGYILERREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSE
EPVIPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWV
RHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGEL
EILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDRQFTIGGLLE
ATEYEFRVFAENETGLSRPRRTAMSVKTKLTSGEAPGVRKEMADVTTKLGEAAQLSCQIV
GRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTDEQEDEGVYTCVATNEVGEVESS
SKLLLQAAPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSEKITI
ENTEHYTHLVMKNVQRKTHAGKYKVQLSNAFGTVDATLDVEIQDKPDKPTGPIVIEALLK
NSVVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFR
VSAQNTFGISEPLEVASIVIIKSPFEKPGVPGKPTITAVTKDSCVVAWKPPASDGGAKIR
NYYLERREKKQNKWIAVTTEEIRETVFSVQNLIEGLEYEFRVKCENLGGESEWSEISEPV
TPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRI
QEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAV
HALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFSNGVERKDAG
FYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKVTNYI
VEKCATTAERWLRVGQARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTVTKED
KTRAMNYDDEVDETREVTTTKASHSKTKELYEKYMIAEDLGRGEFGIVHRCVETSSKRTF
MAKFVKVKGTDQVLVKKEISILNIARHRNILYLHESFESMEELVMIFEFISGLDIFERIN
TSAFELNEREIVSYVRQVCEALEFLHSQNIGHFDIRPENIIYQTRKNSTIKIIEFGQARQ
LKPGDNFRLLFTAPEYYAPEVHQHDVVSTATDMWSLGTLVYVLLSGINPFLAETNQQMIE
NIMNAEYTFDEEAFKEISLEAMDFVDRLLVKERKSRMTASEALQHPWLKQRIDRVSTKVI
RTLKHRRYYHTLIKKDLNMVVSAARISCGGAIRSQRGVSVAKVKVASIEIGPVSGQIMHA
IGEEGGYVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVATMYVKDITKFDDG
TYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTKKVKRRTDAMRLLERPPEFTLPLYN
KTAYVGENVRFGVTITVHPEPRVTWYKSGQKIKPGDDEKKYTFESDKGLYQLTINSVTTD
DDAEYTVVARNKHGEDSCKAKLTVTLHPPPTETTLRPMFKRLLANAECHEGQSVCFEIRV
SGIPAPTLKWEKDGQPLSLGPHIEIVHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTS
CQAHLQVERLRYVKQEFQSKEERERHVQKQIDKTLRMAEILSGTETVPLTPVAQEALREA
AILYKPAVSTKTVKGEYRLQTEEKKEERKLRMPYEVPEPRRFKQATVEEDQRIKQFVPMS
DMKWYKKIRDQYEMPGKLDRVVQKRPKRIRLSRWEQFYVMPLPRITDQYRPKWRIPKLTQ
DDLEMVRPARRRTPSPDYDLYYYRRRRRSLGDMSDEELLLPIDDYLAMKRTEEERLRLEE
ELELGFSASPPSRSPPRFELSSLRYSSPPAHVKVEDRRRDFRYSTYHVPTKEETSTSYAE
LRERHAQASYRQPKLRQRIMAEKEEEELLRPVTTTQRLSEYKSELDYMSKEEKSKKKSKR
QRQVTEITEIEEEYEISRRAQRESSSSVSRLLRRRRSLSPTYIELMRPVSELIRSHPRPA
EEYEDDAERRSPTPERTRPRSPSPVSSERSLSRFERSARFDIFSRYESMKAALKTQKTSE
RKYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQES
SKIHYTNTSGVLTLEILDCQTEDGGTYRAVCTNYKGEASDYATLDVTGGAYTTYASQRRD
EEVPKSVFPELTKTEAYAVSSFKRTSELEAASSVREVKSQMTETRESLSTYEHYASAEMK
SATSEEKSLEEKATVRKIKTTLAARILTKPRSITVHEGESARFSCDTDGEPVPTVTWLRE
GQVVSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSDGKQEAQFTLTVQKARVIE
KAVTSPPRVKSPEPRVKSPETVKSPKRVKSPEPVTSHPKAVSPTETKPTEKGQHLPVSAP
PKITQSLKAEASKDIAKLTCAVESSALCAKEVAWYKDGKKLKENGHFQFHYSADGTYELK
IHNLSESDCGEYVCEVSGEGGTSKTSFQFTGQSFKSIHEQVSSISETTKSVQKTAESAEA
KKSEPIAPESISSKPVIVTGLRDTTVSSDSVAKFTIKVTGEPQPTITWTKDGKAIAQGSK
YKLSSNKEEFILEILKTETSDGGLYACTVTNSAGSVSSSCKLTIKAVKDTEAQKVSTQKT
SEVTSQKKASAQEEISQKALTSEEIKMSEVKSHETLAIKEEASKVLIAEEVKRSAAASLE
KSIVHEEVTKTSQASEEVKTHAEIKTLSTQMNITKGQRATLKANIAGATDVKWVLNGTEL
PNSEEYRYGVSGSDQTLTIKQASHREEGILSCIGKTSQGVVKCQFDLTLSEELSDAPSFI
TQPRSQNINEGQNVLFSCEVSGEPSPEIEWFKNNLPISISSNISVSRSRNVYTLEIRNAA
VSDSGKYTIKAKNFHGQCSATASLTVLPLVEEPPREVVLKTSSDVSLHGSVSSQSVQMSA
SKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGKSSMTQLESSTS
RMLKAGGRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEITWSCGGRKIQNQEQQGR
FHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNINIRSM
NT seq 100404 nt NT seq  +upstreamnt  +downstreamnt
atgactactcaagcaccgatgtttacgcagccgttacaaagcgttgtggtactggagggt
agtaccgcaacctttgaggctcacgttagtggttccccagttcctgaggtgagctggttt
cgggatggccaggtgatttcaacttccactctgcccggcgtgcagatctcctttagcgat
ggccgcgctagattgatgatccccgccgtgactaaagccaacagtggacgatactccctg
agagccaccaatggatctggacaagcgactagtactgctgagcttcttgtgacagccgag
acagcaccacccaacttcagtcagcggctgcagagcatgactgtgagacaaggaagccaa
gtgagactccaagtgagagtgactggaatccctacacctgtggtgaagttctaccgggat
ggagccgaaatccagagctcccttgatttccaaatttctcaagaaggagacctctacagc
ttactgattgccgaagcataccctgaagactccgggacctattctgtaaatgccaccaac
agcgttggaagagctacttccactgcagaattggtggttcaaggtgaagaagtagtacct
gctaaaaagacaaagacgatcgtgtcgactgctcagatttcagaaacaagacaaacccgg
attgaaaaaaagattgaagcccactttgatgccagatcaatcgcaacagttgagatggtc
atagatggtgccactggacagctgccacataaaacacctcccaggatacctcctaagccc
aagtccaggtctccgacaccaccttccattgctgccaaagcacagctggccagacaacag
tccccatcaccaataagacactctccctccccagtcagacacgtgcgggcaccaacccca
tctccagtcaggtccgtgtctccagcggggaggatctccacttccccgatcagatccgtg
aagtcgccactgctcattcgcaagactcagaccaccaccatggccacaggccccgaggtg
cctcccccttggaagcaagagggctacgtggcctcctcgactgaggctgagatgagagag
acgacaatgacaagctctacccagatcagaagagaagagaggtgggaagggagatacggg
gtccaggagcaagtgaccatcagtggagccgcggctgctgcggccagtgcgtcggtcagc
tcgtcattcacggcaggagccatcaccactgggactaaggaggtgaaacaagagacagac
aagagtgcagctgttgcgactgtcgttgctgctgttgatatggccagagtgagagaacca
gccatcagtgctgtagagcaaactgctcagaggacaaccacgactgctgtgcatatacaa
cctgctcaagaacaggcgagaaaagaggcggagaagaccgcagtaaccaaggttgtagtt
gctgccgataaagccaaggaacaggaactaaaatcacgaaccagagaagtgatggtgaca
acgcaagagcagactcacatatctcatgagcagataagaaaagaaactgaaaaagcattt
gtaccaaaggtagtgatctccgcaaccaaagccaaagagcaagaaactagaatcacggga
gaaattactacaaaacaagagcaaaagcgaataactcaagaaacaataagacaggaaact
gaggaaattgctgcatccatggtagtggttgccaccgccaagtccacaaaactagaggca
gctgtgggagttcaagaagagactgccatacaacaggatcaaatgcacctcactcatgaa
cagatgatgaaggaaactaggaaaacagtggtacccaaagtcatagttgccacgcccaag
attaaagagcaagatttagtatcaagaagtagagaagccatcactaccaaaagagatcaa
gttcaaataactcaggaaaagaagagaaaggaagtggaaacaactgccttgtctacaata
gcagttgctactgctaaagccaaagagcaagaaacagttctgaggtctagagaagccatg
gccactagacaagaacacatccaagttacccatggacaggtgggcgttgggaagaaggca
gaagccgtggcaacagttgtagctgctgtggaccaggcccgagtgagggaacccagagag
cctacgcatgtggaggaatcgcattctcagcagactacgttagagtatggctacaaagaa
cacatttccaccacaaaggtcccagagcagccccggcgcccagcctcagagccccacgtt
gtccctcaagcagtcaagcctgctgtgattcaggctccttctgagactcatatcaaaact
actgaccaaatgggaatgcatatatcgtcacaggtcaagaaaactacagatatctcaaca
gaaagattagttcatgtggataaacgcccccgcacagcgagccctcactttactgtttca
aaaatttctgtacctaagacagaacatggatatgaggcatcgatagctggtagcgctatc
gccacactacaaaaagaattgtcagccacatcttcaactcagaagatcaccaaatccgtg
aaggcacccaccgtgaagcctggggagacgagagtaagggcggagcccaccccttcccca
cagttcccctttgctgacatgccgccgccagacacttacaagagtcaggctggcattgag
gtgaagaaggaagtcggggtgagcatcagtggcagcaccgttcgtgaggagcacttcgaa
gtactgcgcggacgtgaagccaaggtaacagagacagcacgagtgcctgctcctgctgaa
gtgcctgttactccgcctaccttggtctcgggcttaaaaaacgtgactgtcatagaaggc
gaatctgtcaccttggagtgccacatctctggatacccatcccccaaggtgacatggtac
agagaagactaccaaatcgaaagttccattgatttccagataaccttccagggtggaatt
gctcgtctcatgatccgcgaagcctttgcggaagacagcggacggtttacctgcagcgcc
gtgaatgaggccgggaccgtcagcacttcctgctatcttgctgtgcaagtgtcagaagag
tttgacaaggaaacaactctgactgagaaatttgccaccgaagagaaacgcttcgtggag
tcaagagatgtagtcatgaccgacaccagcatcacagaggagcaggcagggcctggagag
cctgctgcgcctttcttcatttcaaagccggtggtccagaaactggtggagggtgggagt
gttgtgtttgaatgccagatcggcggcaacccaaagccccacgtctactggaaaaaatct
ggcgttcctctcaccactggatacagatacaaagtgagttataacaagcagactggggaa
tgcagactggtgatttctatgacgttcgctgatgatgctggagaatacactattgtcatc
cgaaacaagcacggggagacgtctgcatctgcctccttgctggaggaagctgattacgag
gcattggtgaagactcagcaagaaatgctttaccagacacaaatgagcacatttattcaa
gaacccaaagtgggggaaatagcacctggatttgcatattctgaatatgagaaggaatat
gaaaaggaacaggccttaattaggaagaaaatggccaaagatactgtgatggtcaggact
tttgtagaagaccaagaattccacatctcttcttttgaagagaggctcattaaagagatt
gaatacagaataataaagactacgctggaagaacttcttgaggaggatggagaagagaag
atggcagtcgacatttctgaatctgaagctatcgagtcaggatttgatataaggataaaa
aattatagaattcttgaggggatgggtgtcacttttcattgcaagatgtctggatatccg
ttacccaagattgcgtggtataaggatggcaagcgcatcagacatggggaaagatatcaa
atggactttctacaagatggcagagccagcctgcgtatacctgttgtccttccagaggac
gagggcatctatactgcatttgccagcaatatcaaaggaaatgcgatttgctctgggaag
ctgtacgtggagcctgctgcaccatttagcgctccaacttacatgcccacaccagaagca
gtgagcagaatcaggtctgtctctccacgttcactgagcaggtcacctatacgtatgtct
cctgcgatgtcccctgcacgaatgtcccccgcacggatgtcccctgcacggatgtccccc
gcacggatgtctcctggacgcaggctggaggagacagatgaatcacagctggagagactg
tataagccagtctttgtattaaaacctgcttctttcaaatgtttagaaggacagactgcc
agatttgacttgaaggttgtgggcagacccatgccagagacattctggtttcacaatgga
cagcaaattgtcaatgattatacgcacaaagtcgtcattaaagaagatggaactcagtca
ctgatcattgtccctgcgtcacccagcgattcaggagaatggacagtggtggcccaaaac
agagcaggaaaatccacaatatctgtgactttaactgtagaagctgtggaacaccagatc
aagccagcatttgtggaaaaactgaaaaatgtcaacataaaggaaggttccaggctcgaa
atgaaagtcagagctacaggcaaccccaaccctgacattgtgtggctgaaaaacagtgac
atcattgttcctcataaatacccaaggatcaggattgaaggaaccagaggagaagccgcc
cttaagattgattccattatcagccaagattcagcctggtatacagccacggctattaac
aaggcaggccgagacaccacaaggtgcaaagtcaatgttgaggttgagtttgcagaacct
gaaccggaaagaaagctgattattccacgaggaacgtacagagcaaaggagattgctgcc
ccagaactggagcctctccatttgagatacggtcaagaacagtgggaggagggtgacctc
tatgacaaggagaaacaacagaaaccgtttttcaagaaaaaactcacttccctcagactg
aagcgctttggacctgcccactttgagtgcagactcacaccaattggtgacccaaccatg
gtggtggagtggcttcacgatgggaagcccctggaggcggccaacaggcttcggatgatt
aatgaattcggctactgcagccttgattatggagcagcgtattccagagacagtggtgtc
atcacctgcagagctactaacaaatatgggacagatcacacctctgctactcttattgtc
aaagatgagaaaagcctagtggaagaatctcaactgcctgatgggaaaaaaggcttacag
aggatagaagaactagagagaatggctcacgaaggtgcgctgacaggtgtgacaacagat
caaaaagaaaaacaaaagccagacattgtcttgttcccagagccagtgagagtgctggaa
ggggagacagccagattccgctgccgagtgacaggctaccctcagcccaaggtcaactgg
tacctcaatggacagctcatccggaaaagcaaaaggttcagagttcgctatgatggcatt
cactatctggatattgtggactgcaaatcctatgacacaggtgaagtcaaggtcactgcg
gaaaatcctgaaggtgtgacggaacacaaagtaaaacttgaaatccaacagagggaggat
ttcagatctgtccttaggcgtgctcccgagccaaagcccgagtttcatgtacacgaaccg
gggaaacttcagttcgaagtgcagaaggtagacagacccgtggacaccagcgaaaccaaa
gaagtggtgaagctgaaaagggctgaaaggattacccatgagaaggtgtccgaggagtct
gaagaactgcgcagtaaatttaagcgccggacggaagagggatactatgaagccatcaca
gccgtggagctgaagtctcgcaagaaggatgagtcttacgaagagctcctcaagaaaact
aaagatgagcttctgcactggaccaaagagttaactgaagaggagaagaaagccttggct
gaagaaggcaaaatcacgattccaacctttaaacctgagcgaatcgaacttagccctagt
atggaggcacccaaaatctttgaacgaatccagagccagaccgttggccaaggatctgat
gctcactttagagtcagggttgtgggaaaaccagaccctgagtgtgaatggtataaaaat
ggtgtaaaaattgagcgatctgaccgaatctactggtactggccagaagacaatgtttgt
gaactggtcataagagatgtaactgcagaggactctgccagcatcatggtaaaggccatc
aacatagctggggaaacctcaagccacgcattcctgctcgtccaagccaagcaactgatc
acttttacacaagaattgcaagatgttgttgctaaggaaaaggacaccatggcaacattt
gaatgtgaaacttcagaaccatttatcaaagtaaaatggtataaagatggtatcgaagtt
catgcaggggataagtataggatgcactctgaccgaaaagttcacttcctgtctgtgctg
accatcgacacatctgatgctgaagactacagctgtgtacttgtggaagatgaaaatatc
aagacgacagcgaaacttattgtggaaggtgcagtagttgaatttgtgaaagaacttcag
gacatagaagtcccagagtcatactcaggagagttagagtgcatcatatctccagaaaac
atagaaggcaaatggtatcacaatgatgtggagttgaagtccaatggcaaatactcaatt
acatcccgccgtgggcgccagaacctcacagtcaaggatgtaaccaaagaggaccaggga
gagtacagctttgttgttgatgggaaaaagacaacctgtaaactgaagatgaaaccccga
cctattgctattctccaaggacttagcgatcaaaaggtctgcgagggtgacattgttcaa
cttgaagtcaaagtctccttagaaaatgtagaaggtgtctggatgaaagatggtcaagaa
gtacaacacagtgacagagttcacattgtaatagacaagcagtcccacatgctacttatt
gaagacatgaccaaagaagatgctgggaattactccttcactattcctgcccttggactc
tccaccagtgggaatgtctctgtctatagtgttgatgtgataacacctctcaaagatgtc
aatgtgattgaaggtaccaaggctgtacttgaatgcaaggtctcagttcccgatgtaact
tctgttaaatggtacctaaatgatgaacaaatcaagcctgatgatcgtgtgcaatccatt
gtcaaaggcaccaaacagcgacttgtgattaaccgaacccatgcttctgatgaaggacct
tacaagctgatggttggcagggtggaaaccagctgtaacctgtctgtagagaaaattaaa
attatcagaggtctccgtgaccttacctgcacagaaacacaaaatgtggtctttgaggtt
gagctatcccactcaggaattgatgttgtatggaattttaagggcaaggaaattaagccc
agttctaaatataaaattgaagctcatgggaaaatatacaaactgacagtcctcaatatg
atgaaagatgatgaaggggagtatgcattctatgcaggagaaaatacaacatctggaaag
ctaactgtggcaggaggagccatctccacaccactcacagaccagactgtggctgaatcc
caggaggctgtgtttgaatgtgaagttgccaaccctgagtctgagggggaatggctgaag
gatggaaagcacttggctctgagtaacaacttcagaggtgaatccgatggccacaaaagg
aggcttgtcatcgctgccgccaagttagatgacgctggagaatatacctacaaggtggct
acctccaaaacatctgccaagctgaaagttgaagctgtcaaaattaagaagaccctgagg
aacctcactgtgacagagacacaggatgcagtcttctctgttgaactcacacacccagat
gtcaaaggggtccagtggatcaaaaacggagttgtcttagattccaacgacaagtatgag
atctcagtcaaagggacactttattcactgaagattaaaaactgtgccatggcagatgaa
tctgtctacggcttcaaactggggaggctaggagctagcgcccggctgcacgttgagact
gtcaagattattaagaaaccaaaggacgtgaccgccttggaaaacgccactgttaccttc
gaagtcagtgtttcccatgacacggtgccagtaaaatggttccataagaacgtggagatt
aagccaagtgacaagcacagactggtctcagagagaaaagtccacaaactcatgcttcag
agcatctccccctcggatgccggcgagtacacagccatggtgggccagctggagtgcaaa
gccaagctgtttgtggagacactccatatcacaaagactatgaaaagtatcgaggttcct
gaaaccaaagctgcctctttcgagtgtgaggtgtcccacttcaatgtcccctccatgtgg
ctaaagaacggagtggaaattgagatgagtgaaaaattcaagatcgtcgtgcaggggaaa
ctgcaccagctgatcatcatgaacacgagcacggaggactcagcggaatacacatttgtt
tgtggcaatgaccaagtcagtgctaccctgacagtgaccccaatcatgattacatccatg
ctgaaagacatcaatgctgaagaaaaagataccataacttttgaggtgacagtaaactat
gaaggcatctcttacaaatggttaaagaacggtgtggagatcaagtcgactgacaggtgc
cagatgagaaccaagaagctcacgcactcgctgaacatcaggaatgttcactttggagat
gctgctgattatacttttgtggctggaaaagccacatcgacggccaccctttatgtggaa
gctcgtcatatagaatttaggaaacacattaaggatattaaggttctggagaagaaacga
gccatgtttgaatgtgaagtttctgagcccgacataactgttcagtggatgaaagatggc
caagagcttcagatagcagacaggataaagatccagaaggagaaatatgtccaccgcctt
ctgatcccatccacacgcatgtctgatgccgggaaatatacagtggtggcaggaggcaac
atgtcaactgctaacctctttgtcgaaggcagggatgtccgcatccggagcattaagaag
gaggtccaggtcattgagaagcagcgtgctgtcgtggagttcgaagtcaatgaggatgac
gtagacgcccactggtataaagatggcattgaaatcaacttccaagttcaagagcgacac
cagtatgtggtggagagaagaattcaccggatgtttatatcagaaacaagacacagtgac
gcaggcgaatacacctttgtggcaggcagaaacaggagttctgtgactctttatgtcaat
gctccagaaccaccccaagtcctgcaggaactccagcctgtcactgtacagtccggcaag
ccggctcgcttctgcgccgtgatatcaggcagaccgcagcccaaaatttcctggtacaag
gaggagcagctgctttccactggcttcaagtgcaaatttctgcacgacgggcaggagtac
acacttctgctcattgaggctttcccagaggatgcggcagtctacacctgtgaagccaag
aatgactacggagtagccacaacgtcggcttctctgtccgtggaagttccagaagttgta
tctccggatcaggaaatgccagtctacccgcctgccatagtcactccacttcaggacaca
gttacttctgaggggcgcccagcgcgtttccagtgccaagtttcagggacagatttgaag
gtgtcttggtactgcaaagacaagaaaatcaaaccatctcggttcttcaggatgacccag
tttgaagacacctaccagctggagatcgctgaagcctaccccgaggacgagggaacgtat
gcctttgttgctaataatgctgtgggccaagtgtccagcactgccaccctgaggctggaa
gcccccgagtcgattctgcatgagaggatcggccagcaaatcgaaatggagatgaaagct
gcccctgtgatcaaaaggagaattgagcccctggaagtagctctgggccacctggccaaa
ttcacctgtgagatccaaggagcccccaacgtccggttccagtggttcaaagctggcaga
gagatctatgagagcgacaagtgttccattcgatcttcgaactatgtctccagcctggag
atcctgagaacccaggtcgttgactgcggggagtacacctgcaaagcctccaatgagtat
ggcagtgtcagctgcacagccacactaactgtgacagaggcgtatccaccaacctttctc
tccaggcccaaggcccttacgactttcgtgggtaaggcagccaagtttctctgcacagtg
tcagggactccggtgattgagatcatctggcagaaagatggcgctgccctgtcaccgtca
cctgactgcagggtcacagacgcagacaacaaacacagtttagaactctcaaatcttact
gttcaggacaggggtatttactcttgtaaggcttccaacaaatttggagcagatatctgc
caggccgagttgaccatcattgacaaaccccacttcattaaagagttagaggctgtacag
tcagccatcaataagaagatccaccttgaatgccaagtcgatgaggataggaaagtcaca
atcacatggagcaaagatgggcagaaacttcctgctgggaaagattacaagatctatttt
gaagataaaatagcatcgcttgagattcccctggccaaactaaaagattctggaacctat
acatgtacagcgtccaacgaggctgggagcagttcttcgtctgctgcggtcgctgtcaga
gaaccgccgtcctttgtgaagaaggtggatccctcttatttaatgctcccgggtgaatca
gcacgcctccattgcaagctgaaaggctcacctgtgatccaggtcacttggttcaaaaat
aacaaagaactcagtgagagtaacacagtccgcatgtcttttgtcaattctgaggctatc
ctcgacatcactgatgtaaaggtcgatgacagtggtacttactcctgtgaagccaccaat
gacgtgggcagcgacagctgcagcactgaagtggtgatcaaagagccgccttccttcatc
aaaactcttgagcccgcagacatagtgcgaggggccaatgcactgctccagtgtgagatc
gcaggcacgggaccctttgaagttaactggtttaaagacaagaagcagatccgaagtagc
aaaaagtacaggttgtttactcagaagacttttgtgtacctggaaatctcatctttcaat
agtgccgacgttggcgattacgaatgtgtagttgctaacgaagtcggaaagtgtggctgt
gtcgcgacacacttattaaaagaaccaccaacctttgtcaagaaagtagatgattttaca
gccctagcaggacagaccgttaccttacaagctgccgtgagagggtcagaacccatttct
gtcatgtggatgaaaggccaagaagtcattaaagaagatggaaaaatcaaaatgagcttt
tccaatggagttgccgtcttgaccatccctgatgttcagattagtttgggtggcaaatat
acatgcctggctgaaaacgaagctgggagccaaacatctgtcggggaattgatagttaaa
gaacctgccaaaatcattgagcgagcagaactaatccaggtgaccgcaggagacccagcc
actctggagtacacagtctcaggcaccccagaactcaagcccaagtggtacaaagatggg
agacccttggttgctagtaaaaagtaccgaatcagttttaaaaacaacattgcccaactg
aaattttattctgctgaactgcacgacagtggccagtacacgtttgagatttccaacgaa
gtgggcagcagctcctgtgagaccacatttaccgtgttagatcgagacattgctccgctt
ttcaccaaacccttacgtaacgtggacagtgtcgttggcggtgcctgcaggttagactgc
aaaattgctggctccctccccatgagggtttcctggtttaaggatggcaaagagctcact
gcttccgacagataccagatagcatttgtggaaggcacagcctctttggagatcagcaga
gtagacatgaatgatgcagggaatttcacctgccgggccaccaattccgtgggaagcaaa
gacagcagcggagccctgattgtgcaagaaccacccagttttgtaactaagccagggtcc
agggatgtcctgcccggctcggcagtctgtctgaagagtgctttccagggctccgcccct
ctcaccatcaagtggtttaagggcgacaaagagttggtttccggtggaagctgctatatt
accaaagaaacttcagagagttccctggagctctacgcagtgaaaacctcggattcgggc
acttacacgtgcaaagtcagcaacgtagccgggagtgtggaatgcagtgcagacttgttt
gtgaaagagcctgctacctttattgaaaagttagagccatcccaactgttaaagaaagga
gatggcactcagctagcctgcaaggtcacgggtacccctccaattaagataacatggttt
gcaaatgaccgagaactgagagagagcagcaaacacaaaatgtcttttgcggagtccacc
gcagttttaaggcttacggatgtggccattgaagacagtggagaatatatgtgcgaggca
caaaacgaggccggcagtgaccactgtactggcattgtcatagtcaaagagtcaccttac
tttaccaaggaatttaagtccattgaagtattaaaggagtatgacgtcatgctgctggct
gaggtggcaggcacccctccctttgagatcacttggttcaaggacaacacaaccctgaga
agtggtagaaagtataaaaccttccttcaggatcagctggtcagcctgcaggtcctcaag
tttgtagctgcagatgcaggtgaataccaatgccgggtgaccaacgaggtcggcagcagc
acctgcagtgccagggtgacattaagagaacccccgtccttcattaagaagattgaagcc
accagctccctccgtgggggcacagccgccttccaggccactctgaaaggctccttgcca
atcactgtgacctggttgaaagacaatgatgagatcactgaagatgacaatataagaatg
acttttgagaacaacgtggctagtctatacctcagtggtattgaagtcaagcatgatggg
aaatatgtctgtcaagccaaaaatgatgcaggcatacaaaggtgttctgcattactctca
gtcaaagaacctgcaacaataatggaggaggctgtgtccatagatgtcactcaaggagac
ccagccactttgcaagttaaattttcagggactaaggagatttcagctaaatggtttaaa
gatggccaagaacttaccctgggtccaaaatacaaaatcagtgtcactgacacagtctca
atactaaagattatttccacagagaagaaggatagtggagaatatacttttgaggtccaa
aacgatgttgggagaagcagctgcaaggctagcattaatgttttagatcttattatacct
ccttcattcaccaaaaaattgagaaaaatggacagcattaaaggatcttttattgactta
gagtgtatagtggctggatcccatccaataagcatccaatggttcaaagacgaccaagaa
atctcagctagtgacaagcacaaattctcttttcatgacaataccgccttcttagagatc
agtcagctggaaggcacagacagtggtacatatacctgttctgccaccaacaaggcaggc
cacagccagtgcagtggtcacctgacagtcaaagaacccccttacttcgtggaaaagcca
cagtcacaagatgtgaatcccggtacgagggttcaattgaaggctcttgtgggtggcact
gcacccatgacaataaagtggtttaaagataacaaggagctgcaccctggggcagctcgc
tcggtttggaaggatgacacctccaccattcttgaactcttctcagccaaggctgccgac
tccgggacctacatttgccagctaagcaatgatgttggcacaacaagcagcaaggccacc
atctttgtgaaagaacctcctcaatttattaagaagcccagtccagtgttagtgctgagg
aatggacagtcaacaacatttgaatgccaagtcacaggcacccctgaaatcagagtttct
tggtatctggatgggaatgaaataacagatcttaggaaatatggcatttcttttgtggat
ggtttagccactttccagatttctaatgccagggttgaaaacagtggaacttacgtctgt
gaagctcgaaatgatgcaggcaccgcgagctgcagcattgaactaaaagtaaaagagcct
cccatctttatccgggagctggagcctgtggaagtggtaaaagacagtgatgtggaactg
gagtgtgaagtcatggggacaactccatttgaagtcacttggctgaagaataacaaggaa
atcagaagtggcaaaaaatacacaatgtctgagaaaatgtcagtgttttacctgcatata
accaagtgtgacccttcagacgttggtgaatatcagtgcatcatagccaacgaaggaggc
agctgtgcttgtagtgctcgggttgccttgaaagaaccaccatcgtttatcaagaagata
gaaaatgtcaccactgtcttgaagagttccgccacctttcagagcaccgtggcaggctca
ccgcccatttctataacctggctaaaagatgaccagattcttgaggaaaatgacaatgtc
catatttcttttgaggacagtgtggccacacttcaagtccggagtgtggacaatgggcac
agtgggcgatacacatgtcaagccaagaatgagtcaggaattgagaggtgttatgctttc
ctcttagtacaagaacctgctcaaatcatagagaaagctaagtcggttgatgttactgag
aaagacccagtcaccctggagtgcgtagtggctggaacaccagaactcaaagtcaaatgg
cttaaagatgggaaacaaattgtacccagtagatatttttcaatgagttttgaaaataac
gtggccagttttaggattcagtcagtcatgaagcaagacagtggacagtacacgttcaag
gtggaaaatgactttggaagcagtagctgtgatgcctacctgagagtgctagaccaagat
attcccccatcgttcaccaaaaagttaaccaaaatggataaagttctgggttcttctatc
cacatggagtgcaaggtttctgggtcacttcctatcagtgctcagtggtttaaagatgga
aaagagatatctacaagtgcaaaatacagactggtgtgtcacgaaaacaccgtgtcactg
gaagttagtaatctggaattagaagacactgcaaattacacctgcaaggtgtccaatgta
gcaggggacaacgcctgtagtggcatcttaactgtgaaagaaccaccaagcttcctagtg
aaacccgagaggcagcaagctataccggattctaccgtggaatttaaggctgtgctgaaa
ggaacaccaccgttcaaaattaaatggcttaaagatgatgtggaacttgtctcaggacct
aagtgtttcattggcttggaagggtcaaccagcttcttaaacctctactcagtggattct
tccaagactggacagtatacttgccaagttaccaatgacgttgaaccaccgaaatttgta
aagaaattagaagcttccaaaattataaaagcaggtgactctgcacgattggaatgcaag
attactggatctccagaaatacaagttgtgtggtatagaaacgaacacgagctcacagcc
agcgataaataccagatgactttcattgactcggtggcggtcatacagatgaacagcctt
gggacagaagacagtggagattttatctgtgaggctcagaatcctgccggcagcaccagc
tgcagtaccaaggttatagtaaaagaaccacctgtttttagcagctttccgcctatagta
gaaacccttaagaacactgaagttagccttgaatgtgagctttcaggaacaccgccattt
gaggtggtgtggtacaaagacaagcgccagctccgaagcagcaagaagtacaaggtcgca
tctaagaatttccatgcgagcattcacatcctcaacgtggaatctacagacattggcgaa
taccactgcaaagcacagaatgaagtgggcagtgacgcttgcgtttgcgctgtaaagtta
aaagaaccaccaaaattcatttccaagctgaacagccttacggtggtagctggcgagcct
gctgagctgcaagcatccatagaaggtgcccagcccatttctgtccagtggcttaaagag
aaagaagaagtgatcagagagagcgagaacattagaatttctttcgtcaacaacgttgca
actctgcagtttgctaaagtggagccagctaatgctgggaagtacatttgccaagtcaag
aatgatggcggagtgagggaaaacatggccacgttgaccgtcttagagcctgcggtcatt
atagagaaggcagggtccatgacggtgactgtgggagaaacgtgtgccctggagtgtaag
gtggctggcactccggagctctctgttgaatggtataaggacggaaagctcttgaccagc
agccaaaaacacaaatttagcttctacaacaaaatctcttccttaaaaatcctctcagtt
gaaaaggaagatgcaggcacctacacattccaggttcagaacaacgttggaaaaagcagt
tgcacagctgtggtcgatgtgtcagaccgaatggtccctccctctttcacacgaagactg
aaggatactggtggtgtcctgggcacctcttgcatcttagaatgtaaagtagctggatcg
tctcccatctctattgcctggtttcatgagaaaactaagattgtcagtggagcaaagtac
caaacaacattttcagataatgtctgcacattgcagttgaattctctggactcatcagat
atgggcagttacacatgtgtggctgctaacgtggctgggtcggatgaatgtcgcgcactg
ttgactgtacaagagccaccctcttttgtgaaagaacctgaacccctggaagtccttccg
ggcaaaaacataaccttcacaagtgttatcagaggaacccctccattcaaggttggctgg
tttaggggagccagagaactggtgaaaggtaacagatgcaatatctattttgaagacact
gtggcagaactggaattatttaatatcgacatatcccagagtggggaatacacctgcgtg
gtttctaacaatgccggccaagcatcctgcactacacgtctctttgtgaaagaaccagcc
acgtttgtaaagaagttaagtgatcactctgtagaaccagggaagtctataattctagag
ggcacctatactggaacacttccaatttcggtcacctggaaaaaagacggtgttagcata
actccatctgaaagatgtaacattgtcaccacggagaaaacgtgcatcctggagattctg
agcagcaccaagggagatgcagggcattactcctgtgagattgaaaacgaggcaggaaga
gatgcttgcgacgctcttgtatctacattagaaccaccttattttgttacggagttagaa
cctctggaggcatctgttggagattcagtttccttgcaatgccaagttgctgggacacca
gaaattacagtgtcttggttcaaaggagacaccaaattaaggtcaactccggaatacagg
acctactttacaaacaacgtggccacacttgtgtttaataaagtgagcatcaatgacagc
ggggagtacacgtgcatggcggagaatagcataggaacagcagcctctaagaccatcttc
agaatccaagagcgccagctcccgccttcctttgcaagacagttaaaggacattgagcaa
actgttggattaccagttaccctcacttgtcgactaaatggctctgcacccatccaagtg
tgctggtatagagatggggtgcttttaagagatgatgaaaatctacagatgtcatttgtg
gataatgtggcaacattaaaaattttgcaaactgacctgagtcactctggccagtattct
tgctcagcttccaatccacttggcacagcatcttctactgctagactaacagcaagagaa
cctaagaaatcacccttctttgatatcaagccagtatcaatagatgttatcgctggagaa
agtgcagattttgagtgtcatgtgactggtgctcagccaatgagagtcacttggtcaaaa
gataacaaggaaatccgacctggaggaaactatactatcacgtgtgtgggtaacactccc
catctgaggattcttaaagtgggcaaaggagactctggccaatacacgtgtcaagccacc
aatgacgttggcaaggacatgtgctctgctcagctcagtgtgaaagaacctcctaagttt
attaagaaattagatgcttcaaaagttgcgaagcagggagaatccatccaactggaatgt
aagataagtggctccccagagatcaaagttgtgtggttccggaatgacagcgaacttcac
gaaagctggaaatacaacatgtccttcgtgaattctgtggccctgctaaccatcaatgaa
gccagtgctgaggacactggggactacatctgtgaagcccacaatggcgttggtgatgcc
agctgcagcacagccctgaaagttaaagcacctcctgtctttacccagaagcctcctcca
gttggagccctgaaaggttctgatgtgatcctgcagtgtgaaatttcaggaacacccccc
tttgaggtggtgtgggttaaagatcggaagcaagtgcgaagcagcaagaaatttaaaatc
acctccaaaaattttgacacgagtcttcatatctttaatctggaagcccctgacataggg
gaatatcactgcaaagccacgaatgaggtgggaagtgacacgtgcgcttgcacggtcaag
ttcaaagaaccaccacgatttgtgaaaaaactcagtgatgcgtccacccttattggggat
cccgtggagttacaagccgtggtagaaggtttccagccgatttccgttgtctggctgaaa
gataaaggtgaagtcatcagagagagcgaaaacgttaggatttcctttgttgataacatc
gcaactctccaactgggaagtccagaagcatcacagtctggaaaatatgtgtgccaaatc
aaaaacgatgccgggatgcgagagtgttcagcagtcctgactgtcctagaaccagccaca
attgtagagaaaccagaacccatgactgtcacaactggaaaccccttcacattggagtgt
gtagtagctgggactccagaactttcagccaagtggttcaaagatggtagagaactatct
tcaggcagcagacatcacattacatttgtcagaaacctggcttcccttaagatcccttct
gcagaaatgaatgacaagggcttatataccttcgaggtggaaaacagagttggcaaaagc
agctgcactgtgtctgtccatgtctcagaccgagttgttccaccgtccttcgtccgaagg
cttaaggacacaagtgccacgctcggagcttctgtggttttggagtgtcgagtgtcgggc
tcagcccccatatcagtcggctggtttcttgatggaaatgagatcattagcagtcccaaa
tgccagtccagctttgcagataacgtctgcactctgactctgagctccctggagccctct
gacactggcgcatacacctgtgtggctgccaatgtagccggccaggatgaaagctctgca
gttctgactgtccaagaaccaccatcttttgaacaaacccctgactctgtggaagttttg
cctggaatgagcctgacattcaccagtgtcattagaggcacccctcccttcaaggtcaag
tggtttaagggcagcagggagctggtgtccggggaggcttgtaccatttctttagaagac
tttgtcactgagttggagctcctggaggtggagccggggcagagtggagattattcttgc
ctggtgaccaatgatgccggcagtgcttcctgtaccacgcatctctttgtgaaagaacca
gccacttttgtgaaaaggttggctgataccagtgtggagacaggtagccccatcgttctg
gaggctacttactctggcacaccacctatctctgtgagctggatgaagaacgaatatcct
ctttcacagtctcccaactgtggcatcaccacaacagaaaaatctagcatcctggaaatt
cttgagagcacaatagaggattatgcacagtacgcttgcctgatagaaaatgaagccgga
caggatatctgcgaagctcttgtgtccgtcttggaaccaccttactttatcgaacccctg
gaacatgtggaagcagctattggagagcccataactttacagtgtaaagtggatggaacc
cctgagatcaggatttcttggtataaggaacatacaaagctacggtcagctcctgcatat
aagatgcaattcaaaaacaacgtggcctccttagtcatcaacaaggtggaccacagtgat
gtgggagagtacacctgcaaggcagaaaacagcgtgggggctgttgcttcttctgccgtg
ctggttatcaaagagcgtaaacttccaccttcctttgcgagaaagctgaaagatgtccac
gagactcttggcttcccagttgcttttgaatgtcgaatcaatggctcagaacctcttcag
gtgtcttggtacaaggatggtgaacttttgaaagacgatgctaatttgcagatgtctttt
gttcatcatgttgccactcttcagattttgcaaactgaccagagccacgttggtcagtat
aactgttcagcttctaatccgcttgggactgcttcgtccagtgctaagctcattctctca
gaacatgaagtgcctcccttctttgacttaaagcctgtgtcagtagaccttgctcttggt
gaaagtggttcttttaaatgtcatgtcactggaacagcaccgatcaaaatcacctgggct
aaagataaccgtgagattcgccctggaggcaactacaagatgactctggtggaaaatact
gccactctgacggtgctcaaagtagccaaaggtgatgctggacagtatacctgctacgcg
agcaacgtggctggaaaggactcttgttctgctcaacttggtgtacaagaaccccccagg
ttcattaaaaagctagaccaatcacggatcgtgaagcaggatgagtatacaagatacgag
tgcaaaataggcgggtctccagaaatcaaggttttgtggtataaggatgaggtggagatt
caagaaagcagtaaattccggatgtcattcgaggactcggtggccatcctggagatgcac
agtctcagtgtggaagacagcggggactacacctgtgaggctcgcaacgcagcagggagc
gccagcagcagcacctccctgaaggttaaagaaccacccgtgttccgcaaaaagcctttt
ccggttgagacacttaaaggagccgatgttcaccttgagtgtgagcttcaggggacacct
ccctttcaagtttcttggcacaaagacaagcgagaacttaggagtgggaagaagtacaag
attatgtctgagaatttgctcacgagcatccacatcctgaacgtagacacggcagacatt
ggggaataccagtgcaaagccacaaacgatgttgggagtgatacctgtgtgggctctgtc
actatgaaagcaccaccacaatttgtgaagaagctcaccgacatttctaccatcattggc
aaagaagtccagctgcagacaacaattgaaggcgctgagccaatttcagtggcgtggttc
aaagacaaaggggaaattgttagagagagtgacaacatatggatttcttactctgaaaac
atcgccaccctccagttttcaagagcagaaccagccaatgctgggaaatacacctgccag
atcaaaaacgatgctgggatgcaggagtgctacgccacgctatcagtgctcgagcctgct
gcaattgtggaaaagccagaatctattaaggtgaccacaggagacacctgtaccttggag
tgcacggtatcaggaacacctgagcttagtaccaagtggtttaaggacggaaaggagctc
acgagtgacaacaaatataaaataagcttcttcaacaaggtgtctggcctcaagatcatc
aatgtggtgcctggcgacagtggggtgtacagctttgaagtgcaaaaccctgtcggcaaa
gacagctgcaaagtctccattcaagtctcagatcgaatcatccctccctcgttcacaaga
aaactgaaagagacgaacggtctgtcgggctcctccgtggtgatggagtgcaaagtgtac
ggatcacccccaatctctgtcctgtggttccatgacgggaatgagatcagcagtggccgg
aagtaccagaccacactgacagacaacacgtgtgccctgacggtgaacatgctggaggaa
gctgacgccggcgactatacatgtatagctaccaatgtggcaggctccgacgagtgtagt
gcccctctgactgtacgagagccaccatcttttgttcagaaacctgacccgatggatgtc
ttaactggcagtaatgtcacgttcacaagcattgtcaaaggctcacctcctttcactgtc
agctggttcaaaggtagcactgagcttgtgcctggggccaggtgcaacgtgtctctgcag
gactcggtgggtgaactggagctgtttgacgtggatacgtcccagagcggagaatacacc
tgcatagttagtaacgaggctggcagggcttcctgcacaacacgtctcttcgtaaaagcc
ccagccatatttgtgaagcgactcaatgactacagcatagagaaaggcaagcctctgatc
cttgaagggaccttctctggaactcctccgatctctgttacatggaagaaaaatggcata
aatgtcatagcttcccaacggtgtaatattaccacaactgaaaaatcagccatcctagaa
attctgagcagcactgtcgaagattcagggcagtacaactgctacattgaaaacgcttct
ggcaaggactcctgctcggcccagatcctgattctagaaccaccgtattttgtcaagcag
ttggagcctgtgaaggtgacggttggtgactctgcctctctacaatgccagcttgctgga
actcccgagattggggtctcctggtataaaggagacacaaagctcaggcccactgccacc
tgcaaaatgcattttaagaacaacgttgcgacactggttttcacccaggttgatagcagc
gacagcggagaatatatctgcagggctgagaacagtgtaggcgaggtttcttcatcaact
ttcctgactgttcaagagcaaaaacttccaccatccttttctcgacaactaagagatgtg
caagagaccgtgggattgccagtggtttttgaatgtgctgtaagtgggtccgagcccatc
tctgtgtcttggtacaaagatggcaagccgttgaaagacagcccaaatatacaaacatca
tttttagacaacatcgccactctgaacatctttaagacagacaggagtctctcgggccag
tactcttgcactgctacaaaccccattggctctgcttcttcaggcgccaaactcatcctc
acagaggggaagaacccacccttctttgatatccctctggcccctatggatgctgttgtg
ggagaaagtgctgacctggaatgccatgtcacgggaacacagcccattaaggtaacctgg
gccaaggacaacagagagatacgaagtggtggaaactaccagatcagctatctggaaaac
agtgcccacctgaccatcgtgaaagtggacaaaggtgactctggccagtacacctgctac
gccgtcaatgaagtgggaaaagactcctgcacagcccaactcaatataaaagagcgcctc
atcccaccgagtttcaccaaaaaactatctgagacggtagaagagacagaagggaactca
ttcaaactggaagggcgtgtggcagggtcccagcccatcaccgttgcttggtacaaaaat
aatgtagagatccacccgacctccaactgtgagatcatgttcaagaacaacgcactgctg
ctgcaggtgaagagggccagcatggccgatgcaggcttatacacctgcaaggcgacaaat
gacgcaggctctgccctgtgcacatcgtccattgtcatcaaagagcctaagaagccgcct
gtgtttgaccagcaccttgccccggtcacggccagcgaaggtgactctgtacagctcagc
tgccacgtgcagggctccgagcccattcggatccagtggttgaaagctggtagggaggta
aagccttcggacaggtgcagcttcagctttgctagcggaaccgccatgctggaactcaag
gagacagctaaagcagattcaggagactacgtgtgtaaggcttccaacgtggctggaagt
gacacttcaaagtgcaaagtgaccattaaagagaaaccagccgcagccccagcagccaag
aaagcagccgtggatggaaaactcttcttcgtgtcagagcctcagagcatcagagtagtg
gaaaaaaccactgccacgtttattgcaaaagttggaggtgacccgatcccgaatgtcaaa
tggacaaaagggaagtggagacagctgaaccaagggggtcgcattcttatccatcaaaag
ggcgacgaagcgaagctggagattcgtgacaccacaaaaaccgattctggcttataccgt
tgcgttgcctttaacaagcacggtgaaattgaaagcaatgtcaacctacaggtggatgaa
agaaagaaacaagagaagattgaaggtgatcttcgcgcgatgctgaaaaagactccagcc
ctcaagaaaggatctggggaagaagaggaaattgatatcatggaacttctcaaaaatgtg
gatcctaaagagtatgagaagtatgcgcgcatgtacggaatcaccgacttccggggcctc
ctccaagcgtttgagctgctgaaacagagccaggaagaagagactcacagactggaaatc
gaggaactagagaagtcagaaagagatgaaaaggaattcgaagaacttgtagcatttatt
cagcaaaggctgacacagacagagcctgtcactttgatcaaggatattgaaaatcagaca
gttctgaaagataatgacgccatctttgaaattgacattaagattaattatccagaaatc
aagctttcctggtacaaagggactgaaaagctggagcccagtaacaaatatgaaataagc
atcgatggtgaccggcacacactcagagtcaaaaactgtcagcctaaagatcagggcaat
taccgtctggtctgtggtccccacatcgctagtgccaagctaactgtgattgagcccgcc
tgggagcggcatctccaggacgttactctgaaggaaggccagacttgtaccatgacgtgt
cagttttctgtaccaaatgtgaaatctgagtggttcagaaatggcagagtccttaaacct
caaggcagagtgaaaacggaagtggaacacaaagtccacaagctgaccattgccgatgtc
cgtgcagaggaccagggtcagtacacctgcaagcacgaagacctcgaaacttcagcagag
ctcagaatcgaagccgaacccattcagtttacaaagcgcatacagaacatcgtggtgagc
gagcatcagtctgctactttcgagtgcgaagtgtcctttgacgacgccatagttacctgg
tacaaaggaccaacagagctgactgagagccagaaatacaactttagaaacgacggccgc
tgccattacatgacaatccacaatgtgaccccagatgacgaaggtgtctattcagtaatt
gctcggctggagccaagaggcgaagcaagaagcacagcggaactgtacttaacaaccaaa
gaaataaaacttgagatgaagcctcctgatattcccgattccagagttccaatcccaacc
atgcccatcagagctgtcccaccggaagaaatccctcctgcggttgctccttccatccct
cttttgctgccattacctgaagagaagaagccgccagcaaaacgaattgaagtgaccaaa
aagggtgtgaaaaaagataccaaaaaagttgtcacaaagcccaaagaagaggccccacca
ccaccagtcccagaagttgccaagaagcctccacctcctactcccatgattccagcaaaa
gcttctgagattattgacgtgtcctctaaggctgaagaggtaaaaataacaaccatcacc
agaaagaaagaggttcacaaagagaaagaggctgtgtatgaacgagaggaagcagtctac
gaaaagaaagttcacatagagccttgggaagagccctatgaggaattggaaacggaacca
tacacagagccatatgaagaaccctattatgaagaaccagatgaagactatgaagagatc
aaggtggaagctaaaaagcaagtccacgaggaatgggaggaggactttgaagaaggacag
gagtactatgagagagaagagggctacgatgaaggggaggaagagtgggaagagatttac
catgaaagagaaataattcaggttcagaaggaggttcatgaagaattacatgagaagaaa
atcccagccaaagtgcctgaaaagaaagtaccacctcccaaagttgtaaagaagccagta
gttgaaaaagttgaaaagactactcggagaatggaggaagaaaaagttcaagtcatcaaa
gtacctgaagtttctaagaagattgttccacaaaaaccttcccggactccagtgcaggaa
gaaataattgaagtgaaagtaccagctgtgcacacaaagaagatggttatctctgaagaa
aagatgttctttgcttctcacacagaggaagaggtgtctgtctcagtccccgaggtgcaa
aagaaaactgtcactgaagagaaaattcacgttgcagtttccaaaaagattgaaccacca
cccaaagtccctgaaccacctaaaaagccagttccagaagaagtggtccctgttcccatt
cctaagaaggtggaacccccagcagccaaagttcctgaggctcccaagaaacctgtgcca
gaggagaaaaagccagttcctattcccaagaagaaagagccagctgcccctccacaagtc
ccagaggctccaaagaaacctgctcccgaagaaaagattcctgttcctgtgacaaagaag
aaggaagcccctccagctaaagttcctgaagtgcagaagaaggttgtcacagaagaaaaa
atagccatcattactcaaagagaggagtcccctccaccagcagtaccagaaataccaaag
aagaaagttcccgaagaaaaaagacctgttcctagaaaagaggaagtccccccaccaaaa
gtgccagtgccacctaagaaagctgttcctgaggcggttgttccagctcccatccctaag
aaagctcctccccgagctgaagtttctaagaaaactgttgtagaagagaaaagatttgct
gctgaagaaaaactatcggtggcagttcctcagagagtggaactcatgcggcacgaagag
gaggaatggacttactctgaagaagaggaaagagtgtctgtttcggtgtatagggaagag
gaaagagatgaggaggaagcagaaatcacagagtatgaagtgttggaagagcccgaggaa
tatgttgtggaagaaaagatgcactttatctctaagaaagtggaagttgaaccagccaaa
gtgcctgagaagaaaattataccaaaaccaaaagttcctgctaaaattgaggagcctcca
cccactaaagttcccgaaccaccaaagaaaattgtaccagagaagaaagttcctgcacca
gctcccaaaaaggtgccgccagccaaagcccctgaagaatcaaagagaccagttcccgag
aagagggctcctgcagaagaggttgggatagaagaacctcccccaaccaaagtggccgaa
aggcacatgaaaattacccaggaagaaaaagttcttgtggctgtaactaaaaaggaggcg
cctccgagagcgagagtgccagaggaacctaagaaagttgcccctgaagaaagatttccc
aagctcaaacctcgaagagaggaggagccaccagctaaagtgaccgaagttagaaaaaga
gctgttaaagaagaaaaggtgtccattgaagttccaaagagagaaccccgacccactaaa
gaagtgactgtgacagaagagaagaaatggtcttacacccgagaagaagaaactgtttca
gaacatcgggaggaggagtatgaggattacgaagactatgaggagtataaagagtttgag
gagtacgaacccaccgaagaatatgaccagtatgacgagtatgcagagcgtgaggtggag
cactatgaagagcatgaggaatacgtcacagaacccaagaagcctgtcccagtgaaacct
gcccaagaaccggtgcctgctaaacccaaggctcccccaccaaaagtgctaaagaaagct
gtccctgaagaaaaagcacccctgcccattcaaaagaaactcaaacctctgccacccaaa
gctcccgaagaaccaaagaaagttgttgaagaaaaaatacagatttcaattaccaaacgt
gaaaagcagcaggtgactgaaccggtcgccaaagtgcctatgaagcccaagagagttgtc
ccagaggcaaaaatacctgcccctacaaaggaagtggcagtgcctgttagagaaagccta
tcttttgttatatgtgggtctgtgctcttaaaatgtctcaactttattgaggaattagaa
aatagccaacttaaagatgatatctttaaagtgccaggggtacccaaaaaacgagaactg
gaagaggttgttgtcttcaaagaggaggtggaagcccatgaagaatacattgtagaggaa
gaagaggaatatgtccatgaagaggagtatgtccacaaagaagaatatgtccatgaagaa
gagtacgtccataaagaggaatatatccacgaagaggaagaacaccttcatgaagaggag
gagaccatagctgaggaagaggtggtgcctgtggccccagtcaaagtgcctgtggtaccc
aagaaacctgttccagaagagaaaaaacctgttcctgttcccaaaaagaaggaagcacca
ccagccaaagtgcctgagattcccaagaagccagaggaaaaagttcctgtgcctattcct
aaaaaggagaaggctccacctgccaaagtcccggaagtgcccaagaagcctgtaccagag
gagaagccaccagtacctgttcccaaaaaggtggaaccaccaccagccaaagtgccagaa
gtgccgaagaaacctgtgcctgagaagaaggtaccagcgcctactcctaagaaagtagag
gctcctcctgcaaaagtgccagaggtgcccaagaaacccattccagaagaaaagaaacca
acagctcttctgaaaaaaatggaagccccacccccgaaagcgccaaagaaacgggaggta
gtcccagttcctgtggctctacctcgggaagaagaagaagaagaagtgccatttgaggaa
gttcctgaagaggaaattctacctgaggaagaagttccatctgaggaggaagctccacct
gaagaagttccaccagaggaagaggaagttcttcctgaagaagaggaagttcttcctgaa
gaagaggaagttcttcctgaggaagaggaagttcaacctgaggaagaagctcttccagag
attaaacctaaggtgccaaaacctgcaccagtgcctgagatcaagaagaaagtgccagag
aagaaagtagttgttcccaagaaagaggaggctcctcccaccaaagttcctgaggtgtct
aagaaggtggaagaaagacggatcatcccccctaaagaagaggaagttccaccagctgaa
gtatatgaggaggctgaagaacccactccagaagagattccagaagagccgcctagcata
gaagaagaagagatagtggaggaagaggaggaggaggaggaggtgctgccacctagagca
cctgaagtggtgaagaaagcagtacccgaagctcccactcctgtccctaagaaagcggag
gcaccccccgcaaaagtgccaaagaaaatccctgaggaaaaggttcccgtgccggtccag
aaaaaagaggccccaccagccaaagtgcctgaagtgccaaagaaagtcccagaaaagaag
aaaatccctgaaaagaaagtccctgtgcccaaaaaggaagctgttccaccggctaaaggg
aaagctgtttttgaagaaaaaatatcagttgcctaccagcaagaagaactagtccaagaa
agaatagagctagaactcgtggaagccaaagtggaagaggctttcgaagaagaggagttc
cacgaggtgcaggaatactttgaggaagaggagttccacgaggtggaggagttcatcagg
gtggaagagcgcaggttccaagaagagcacaaagtggaagaagtccacagggtcattgag
ttcctagaggctgaagaagtggaagtatacgaaaagcccaaaattccacctaaaaaagga
cctgaggtatctgagaaagtcatccctccaaaaaagccacccactaaagtcattcctcga
aaagagccaccagctaaagtacctgaggtgaccaagaaaacggtggttgaagaaaaaatc
cgtgctcctgaagaaccgaaggtgccggcacctaaagaagttgttcctgaaaagaaagtc
tccgtggtgcctcccaaaaagccagaagccccacctgccaaagtgccagaggcacccaag
gaagctgcccctgagaagaaagtgccagtggcacctaagaaaaagccagaagccccaccc
gtgaaagtacccgaggtgccaaagacagctgttccccaaaagaagatccctgaggccatt
ccccccaaaccggaaagtcctccccttgaagtgccagaggctcccaaagaagttgttcct
gaaaagaaagtctccgtggtgcctcccaaaaagccagaagccccacctgccaaagtgcca
gaggcacccaaggaagctgcccctgagaagaaagtgccagtggcacctaagaaaaagcca
gaagccccacccgtgaaagtacccgaggtgccaaaggcagctgttccccaaaagaagatc
cctgaggccattcctcccaaaccagagagtcctccccctgaagtgtatgaggaacctgaa
gaggagattgtcccagaagagcctccagaggaggctgtggaagaaccagtgccagctccc
cctccaaaagtgacagagccacctaagaagcctgtccctgagaagaaagcgcctcctgct
gttgtcaagaaacctgaacccccaccagcgaaagtgcctgaagtgcctaaggaagctccc
cctgaaaagaaagtgcctcccaaaaagccagaagccccacctgctaaagtgccagaagtt
ccgaaagaagttgtcacagaaaagaaagtggctgttcccaaaaagccagaagtcccgcca
gccaaagtgccagaggtgccaaagaaacctgtcattgaagagaagccagccattcctgtt
gttgagaaagtggcgtcccctcctgctgaagtatatgaagaaccggaagaagtcactgct
gaggaagaggagccagcccctgctgtagaagaggaggaatacgaagctccccctccccct
gcaccagtgcctgaagagcctaagaaggttgtcccagagaagaaatttcctgtcatcaaa
aaaccagaggctccccctcctaaagaacctgagccagagaagaaggttatcgagaaacca
aaactcaaaccaagaccccctgcacgtcctccttctccacctaaggaagatgtgaaggag
aaaatgttccaacttaaagctgtttcaaagaagaaagttcctgaaaaacccgaggttgtg
gaaaaagtggagcctgcaccactaaaagtgcctacagctgaaaagaaagttcgtaaatta
cttcctgaacctaagccgcagccaaaggaagaggtggtgctgaaaagcgttctaagaaag
aaacccgaggaagaagaacctaaagtagaacctaaaaaagtagaaaaagctaaaaaaccg
gaagagccacagccacctccaaaagccgttgaagttgaagctcctccagagcctacacca
aaggaaaggaaagttccagaaccggccaaagttcctgaaattaagccagcgatacctctc
cctggacctgaaccaaagccaaagcctgagccagaggtgaaaaccatgaaagctccaccc
atcgagccggcacccactcccatcgctgcccccgtgacagcgcctgtggttgggaagaaa
gcagaagccaaacctaaggatgaggctgccaagccaaaaggtcccatcaaaggtgtagcc
aaaaagactccttcaccaatagaagctgaaaggaaaaagctcagaccaggaagcggtgga
gagaaacctccagacgaagctccgttcacttaccaactcaaggccgtgccactgaaattc
gtgaaagaaatcaaagacatcgttttgacagaggcagagtctgtgggctcttctgccatc
ttcgaatgtttggtctccccatccactgccattacaacctggatgaaggacggcagcaac
atccgtgagagcccaaagcacagattcattgcagacggcaaagacaggaagctgcacatt
atcgacgttcagctgtctgatgctggtgaatacacctgtgtgctacgcttgggaaataaa
gagaagacgtccactgctaagctcatcgtagaagaacttcctgtgcgctttgtgaaaaca
ctggaggaggaagtcacggtggtcaaggggcagccgttgtacttgagctgtgagttgaac
aaagaacgcgatgtggtctggaggaaggatggtaagattgtggtggagaaacctggcagg
atcgtgcctggtgtcattggcctgatgcgggccctgaccatcaatgatgctgatgacact
gatgccggaacatacactgtgactgtggaaaatgccaacaacctggaatgttcttcttgt
gtaaaagtagtagaaatcattagagaatggcttgtgaaacctatccgagatcagcatgtg
aagcccaagggaacagctgttttcacctgtgacatagccaaggacacgccaaacattaag
tggttcaaaggctatgacgagatccccttggaaccaaacgacaagactgagatactgaaa
gagggaaaccacctctttctcaaggttaagaatgctatgccagaagatattgatgagtat
gcagtggaaattgaagggaaaagatacccagcaaagctgacacttggagagcgcgaagtt
gagctacttaagccgatagaagatgtcaccatttatgagaaggaaagtgccagctttgat
gcagaaatctcagaggaagacattcctggggagtggaagctgaagggcgagcttctgcgg
ccctcgcctacttgtgaaatcaaagctgaaggtgggaagcgcttcttaactttgcacaaa
gtgaaactggaccaagctggcgaagtcctctaccaggcttgcaatgcgatcacaactgcc
attctgacagtcaaagaaatcgagcttgactttgctgtacccctgaaggatgtgactgtc
ccagagaagagacaggctcggtttgaatgtgtcctcaccagagaggcaaatgtcatatgg
tctaaagggcctgatataatcaaggcatctgacaaatttgatattattgctgatggaaag
aaacacattcttgttatcaacgactctcagtttgacgatgaaggagtctatactgcagag
gtggagggcaagaagacgtcagcacaattatttgtgacaggcataagacttaagttcata
tcaccactggaagatcaaacagtaaaagaaggccaaacagcaacttttgtctgtgagctc
tctcatgaaaaaatgcacgtggtctggttcaaaaacgatgtcaagctacacacaaccagg
acagtgctcatgtcttctgagggaaagacttataagctggagataagggagaccacactg
gatgatatctcacagatcaaagctcaagtgaagaacctcagctctacagccaacctgaag
gtcttggaggccgatccctacttcaccgtgaaattacacgacaagactggcgtggagaag
gacgagatcattcttaagtgtgaagtgagcaaagatgttccggtcaaatggttcaaagac
ggggaagagattgtgccttcgcccaaacattctgtcaagaccgacggcctgcgccgcatc
ttaaagatcaagaaggcagagctcaaagacaaaggggaatatgtgtgcgactgcggtaca
gacaccaccaaggccaacgtcactgttgaggctcgactcataaaagtggagaaacccctg
tacggcgtggaagtgtttgtgggtgaaaccgcccgctttgaaattgaactgtctgaacct
gacgtgcatggccagtggaagttaaagggagagcctttgactgcttctcctgactgcgaa
atcatcgaagatgggaagaaacatgtcttggttctgtataactgtcagctggatatgacc
ggggagatatccttccaggccgccaacgctaaatcagcagccaacctgaaagtgaaagaa
ctgccgctcattttcatcacccctctgagtgacgtcaaagtctttgagaaagatgaggcg
aagtttgagtgtgaagtatccagggagcccaaaacattccgctggctgaaaggaacccag
gaaatcactggtgatgacagatttgagctcatcaaggatggcaccaggcattcattggtg
atcaagtcagcagcttttgaagatgaggccaaatacatgtttgaagctgaagataaacgc
acaagcggcaaactgatcattgaaggaatccgtctcaaattcctgaccccactcaaggat
gtgacagccaaagaaagggaaaatgccgtgtttactgtggagctgtcccatgacaacatc
ccagtgagctggttcaagaacgaccagcgcctgcacaccagcaagcgggtctccatgcat
gatgaagggaaaacacactccatcacgttcaaagacctgtctattgacgacacctcccaa
attagagtggaggccatggggataagttcagaggctaagctcactgtgctggagggagac
ccatacttcacaggaaagcttcaagattacacaggcgtggagaaggatgaagtgattctt
cagtgtgaaatcagcaaagcagacgcacccgtgaaatggtttaaggacgggaaggaaatt
aagccgtctaaaaacgttgttatcaaggctgacggcaagaaacgcatgctgatcctgaag
aaggccttgaaatcagatatcggccaatatacctgtgactgtgggacagaccagacctct
gggaagctggacattgaagatcgggaaattaaactggtgcgacccctgtacagcgtggag
gtgatggagaccgagacggcccgctttgaaactgagatctctgaagatgatatacatgcc
aactggaaactgaagggagaggcactgctccaaacacctgaatgtgaaattaaagaagaa
ggcaagatccacgtccttatcttacacaactgccgcctagaccagactggaggtgtagat
ttccaagctgccaatgtcaaatctagtgcccacctccgagttaaaccacgggtaattggt
ctgctgaggcctctaaaggatgttacagtgaccgcaggggaaacggccacctttgactgc
gagctctcctatgaggatatcccagtggaatggtacctcaaagggaagaagctggagcct
aacgataaggtggtgacacgttcagaaggaagagttcacacgctcaccctgagggatgtg
aagctagaagatgctggcgaagtccaactaactgcaaaggatttcaaaactcaggccaat
ctctttgtgaaagaacccccggttgagttcactaagcctcttgaggaccagacggtcgaa
gaggaggccactgcagtactggagtgtgaagtatccagagaaaatgccaaagtgaaatgg
ttcaaaaatgggacagaaatcctcaaaagcaagaagtatgaaatcgttgctgatggcagg
gtcaggaagctcattattcatggttgtaccccagaggatatcaaaacgtacacttgtgat
gctaaagattttaagacctcctgtaacctgaatgttgttcctcctcatgtggaattctta
agaccactcacagacctccaagtcaaagaaaaagaaactgctcggttcgagtgcgaaatt
tccaaagaaaatgagaaggttcagtggtttaaagatggtgctgaaattaaaaagggcaaa
aagtatgacatcatttctaagggagcagtacgaattcttgtcatcaacaaatgtctactg
aatgatgaagcagaatattcctgtgaagtgaggacagcaagaacttccggcatgctgaca
gtcctagaagaagaagctgtcttcacaaaaaatcttgccaaccttgaagttagtgaagga
gacactatcaaactggtgtgtgaagtctccaagcctggggcagaagtgatttggtacaaa
ggggatgaggagatcatcgaaacagggagatttgaaatacttactgatggaaggaagaga
atcttgatcattcagaatgcgcagcttgaggatgcaggcagctacaactgtcgactccca
agttctcgaacggacagcaaagtcaaagtacacgaacttgctgctgagttcatctcgaag
cctcaaaaccttgaaattcttgaaggagaaaaggctgagtttgtctgcactatctcaaag
gaaagcttcgaagttcagtggaagagggatgatcagacacttgaatctggagataaatat
gacatcattgctgatggcaaaaagagagtcctagttgtaaaggatgccacattacaagac
atgggcacttacgtagtcatggttggggctgccagagccgcagctcacctgacagtcatt
gaaaaactcaggatcatagttcctcttaaggacaccaaggtgaaggaacaacaagaggtt
gtcttcaactgcgaagtcaatactgaaggtgccaaagccaaatggttcagaaatgaagaa
gccatatttgatagttcaaaatacatcattctccaaaaagacctggtctacaccctcaga
atcagagatgcacggttagatgaccaagccaactttaatgtgtctttgaccaatcacaga
ggtgaaaatgttaaaagtgcagccaatctaatagtggaagaggaagatcttaggattgtt
gaacctcttaaagatattgaaacaatggagaagaagtcagtcacattctggtgcaaggtg
aatcgtctcaatgtgacactgaagtggaccaaaaatggagaagaagtggcttttgacaac
cgtatatcataccgaattgataagtacaaacactctctaatcatcaaggactgtggcttc
ccagatgaaggtgaatacgtcgtcactgctgggcaagataaatccgtggcagagctgctc
atcatagaagccccaacagaattcgtggagcacctggaagaccagacggtcacagagttt
gatgacgctgtcttctcctgccagctctccagagagaaagcgaatgtaaaatggtacaga
aatggaagagaaatcaaggaaggcaaaaaatacaagtttgagaaggatgggagcatccac
aggctcatcataaaagactgcaggctggaggatgagtgtgaatacgcttgtggtgtagag
gaccgcaagtcccgagctagactttttgtagaagaaattccagttgagattatcaggcct
cctcaagacattcttgaagcccctggtgcagacgttatcttcttggctgagctcaacaaa
gataaagtggaggtccaatggcttagaaataacatgatcgtcgtccagggtgacaagcac
cagatgatgagtgaaggaaagatacacaggctacagatttgtgatattaagccacgtgac
cagggcgaatacagattcattgccaaagataaagaagccagggctaaacttgaattagca
gctgcacctaaaatcaagacagctgatcaagatctcgtcgttgatgctggccagcctctg
acaatggtggtaccctatgatgcctaccccaaagcagaagctgaatggtttaaagagaac
gaacctctatctacaaaaaccgttgacactacggctgagcagacttctttcagaatctca
gaagccaagaaggacgacaaggggaggtataaaatcgtgcttcagaacaagcatgggaaa
gcagagggcttcatcaatttacaagttattgatgttcccgggccagttcgtaacttagaa
gtgacagaaacatttgatggtgaagtaagcctcgcctgggaggaaccactaacggatggt
gggagcaaaatcataggctatgttgttgaaaggcgtgatatcaagagaaagacctgggtt
ctggtcactgaccgagcggacagctgtgagttcactgtcactggactacagaaaggagga
gtggagtacctgttccgtgtgagtgcaaggaacagagttggcactggagaacccgtagaa
actgacagtcctgtagaagcaaggagtaaatatgatgttccaggccctcctttgaatgta
accatcaccgatgtgaatagatttggtgtctcactaacatgggagccaccagagtacgat
ggaggtgctgaaatcacaaactatgtgattgagctgagagacaagacttctatcagatgg
gacactgccatgaccgtaagagctgaagacctgtcagcaactgtcactgatgtggttgaa
ggacaggagtatagtttccgtgtcagagcccagaaccgaatcggagttgggaaaccaagt
gcagccacaccctttgtcaaagttgctgatccaatagagagaccaagtcctcctgtgaac
ctaaacgcctcagaacagacacagtcatcagttcagctcacctgggagcctcctctgaaa
gatggaggcagccccatactgggctacataattgaaagacgtgaagagggaaaagacaat
tggattcgctgcaatatgaaacctgtccctgaactgacttacaaggtcactggattgcaa
aaagggaacaaatatttatatagagtgtctgcagaaaatgcagctggtgtttcagatcca
tctgagatcctcggtcctctcactgctgatgatgcgtttgttgaaccaacgatggattta
agtgcattcaaagatggtttggaagtcatagttcccaatcccatcaagatcctggtccca
agcacaggctatccaagaccaaaagcaacctggacttttggagatcaagtacttgaagag
ggggatcgtgtgaaaatgaagaccatatcagcctatgccgagcttgtcatttctccaagc
gaacgaacagacaaaggcatttacacactcacgttagaaaatcctgtgaagtcaatttct
ggagaaatcaatgtcaatgtaattgctcctccaagtgcgcccaaagaactgaaatttagt
gatataacaaaggattctgtacatttgacttgggaaccaccagatgatgatggagggagt
ccactaactggatatgttgttgaaaagagagacatgagccggaaaacatggactaaagtt
atggactttgttactgatctagaattcacagttcctgatcttgttcaaggaaaggagtat
ctattcaaagtctgtgcccgaaataagtgtggccctggagaacctgcatatactgatgaa
cctgtaaatatgtctgcccctgcaacggtacctgacccaccagagaatgttaaatggaga
gacaggacagccaacagcatcttcctaacatgggatcctcctaaaaatgatggtggctct
cgtatcaaaggatatatagttgaaaaatgtccacgtggttctgataaatgggttgcctgt
ggagaacctgttccagatacaaaaatggaagtgacaggtcttgaggaaggcaaatggtat
gcctaccgtgtgaaggccttgaacaggcaaggtgctagcaagccaagcaaacccactgaa
gagatccaggcggtggacacacaggaggcccctgagatcttcctggatgtgaagctcctg
gctgggatcactgtgaaagctggaacgaagatcgaacttcccgccacggtgactggaaaa
ccggaaccgaaaataacttggaccaaggctgacacccttctgaagccagaccagagaatc
accattgaaaacgttcctaaaaaatccacagtgacaatcacagacagtaagagaagtgac
acaggcacatatatcatagaagccgtgaacgtctgtggccgggccactgctgtggtagaa
gtgaatgtcttagataaacctggaccaccagctgcctttgacatcacagatgtaaccaat
gagtcgtgtcttctgacctggaacccaccaagagacgatggcgggtctaagatcacaaac
tatgtggtggagagaaaagcaacagacagtgatgtgtggcataagctctcatcaaccgtt
aaggacacaaacttcaaggcaaccaaattaacacccaacaaagagtacatcttcagagtt
gctgcagaaaatatgtatggtgttggtgagccggttcaagctgctccaataatagccaaa
taccagtttgatccacccggacctccaactcgcctagaaccttccgacatcactaaagat
gcggtgacgctcacatggtgtgagccagatgatgatggtggcagtcccatcactggatac
tgggttgaaagattagatcctgacactgataaatgggttcgatgcaataagatgccagtg
aaggacacaacatacagggtaaaaggtctcaccaataagaaaaagtacagattccgcgtg
cttgctgaaaatttggcagggccaggaaaaccaagtagatcaactgaaccaatcttaata
aaggatcccatagatcctccatggccccctggaaaaccaactgtaaaggatataggcaaa
acctccttagtattgaactggaccaagccagaacacgatggaggggcaaagattgagtct
tacgtcattgagatgctaaagaccggaacagacgagtgggtcagggtggctgagggagtt
ccgaccactgagcatttgctcacagggctaatggaaggccaggaatactcattccgagtg
agagccgtgaacaaggctggagagagtgagcccagtgaacccagcgaccctgtgctttgc
cgggagaaactatatcctccatcaccacctcgctggctcgaagtgattaatatcacaaaa
aatacagctgacctaaaatggacagttccagagaaagatggagggtcacccatcaccaac
tacattgtggaaaagagagatgtgagacggaaaggctggcaaacagtggacaccactgtc
aaggacaccaagtgcacggtcaccccactgacagaggggtctctgtatgtgttccgagtt
gctgcagaaaatgccataggacaaagtgactacacagaaatcggagattctgtcctggcc
aaagacaccttcaccacccctggaccaccctatgccctgacagtggttgatgtgacaaaa
cgacatgttgacctaaagtgggagccacctaaaaatgatggcggaagaccaatacagaga
tacatcattgagaagaaagaaaaattaggtacccgttgggtgaaagccgggaagacctca
ggccctgactgtaacttcagagtaactgatgtcattgaaggaacagaagtccagtttcaa
gttcgggcagaaaatgaagcaggagttggtcacccaagtgagcccacagaaattctgtca
atcgaagacccaacaagtcctccttcacctccgcttgatctacatgtgactgatgctggg
agaaaacacattgccattgcttggaaaccaccagagaaaaatggcggaagtcctatcata
ggctaccatgttgaaatgtgtccagtaggcacagagaaatggatgcgagttaattctcgc
ccaataaaagatctgaagttcaaggttgaagagggtattgttccggacaaagaatatgtt
ctgagagtgagagctgtcaatgctgtcggtgtcagtgagccatctgaaatctccgaaaac
gtggtcgccaaagacccagactgcaaaccaactattgatctagagactcacgacattgtt
gttatcgaaggagaaaagttaaacatccctgtgcccttcagggctgtcccagtgccaacc
gtgagctggcataaagatggcaaagaagttaaagcaagtgacagattgacaatgaagaac
gaccacatctctgcacacctcgaggttcccaagagtgtccatgcagatgctggagtgtac
accatcaccctggagaataagctcggctcagcaacggcttcaatcaatgtcaaagtcata
ggtctacctggtccatgcaaagatattaaagcaagtgacataaccaaaagttcttgtaag
ttaacatgggaacctccagagtttgatggtggaagcccgattcttcattatgtcctggaa
cggagagaagcagggaggaggacatatatcccagtcatgtctggtgagaacaaactgtct
tggaccgtaaaagatctcataccaaatggtgaatacttcttccgagtaaaagcagtcaac
aagattggcggaggagaatacattgaactcaagaatcctgtcattgctcaagatccaaag
caaccacctgatccacctgtagatgttgaggttcataatcctacagctaaggcaatgact
atcacgtggaagccacccttgtatgatggaggaagcaagataatgggttacatcatagaa
aagatcactaagggtgaggatagatggaagagatgcaatgaacatctggtccctgtcctg
acctacacagcgaaaggactcgaggaggggaaagagtaccaattccgtgtgcgagcggag
aacgctgctggtattggtgaaccttcccgggccactcccccaaccaaagctgtcgaccct
attgatgccccaaaagtcatcctcagaacaagcctggaagtaaagcggggtgatgaaata
gcacttgatgcaaccatctctggctcaccatacccaacaatcacatggataaaagatgaa
aatgtcattgttccagaggaaattaagaagcgagcggcacccccagttaggaggaagaag
ggcgaggctgaagaggaggagcccttttccctccctctgacagaacgtctgagcatcaac
aatagcaaacagggagaatctcagctgcgcatccgtgactctctgcggcctgaccatggc
cagtacatgatcaaagttgagaatgatcacggtgttgcaaaagctccttgctccgtcagt
gtgttagatacaccaggaccaccaatcaactttgtatttgaggatattagaaaggactct
gtcctgtgtaagtgggaaccaccgcttgacgatggtggcagtgaaatcattaactatacc
ttggaaaagaaagacaagaccaagcccgactcagactggattgttatcacatcaacactc
agaaactgcaaatattcagtaacaaaactgattgaaggaaaagagtacctcttccgtgta
agagctgaaaataggtttggacctgggccaccatgtgtttcaaagccacttttagccaaa
gatccatttgaaccacctgatgcaccagataaacccattgtggaagatgtcaccagcaac
agtatgctagtaaaatggaatgaaccgaaagataatggaagccccatcttgggttactgg
cttgaaaaacgtgaggtcaatagtacacactggtctcgtgtcaacaaaacccttctcagt
tctttgaaaaccaaggtagatggcttgctggaaggactcacctatgtcttccgagtttgt
gctgaaaacgctgctggacctggaaagttcagcccaccttcggatcctaaaacagctcgc
gatccaatctctccacctgggccgcctgtcccgagagttgctgatacaagctctacaacc
attgagctggagtgggaacccccagctttcaatggtggtggggaaattatgggctacttt
gttgataagcagctggttggcacaaatgagtggtcacgctgcacagagaagatgatcaaa
gtccgtcagttcactgtcaaagaaatccgagagggtgccgactacaaacttcgagtgagt
gctgtcaatgcagcaggcgaaggaccacctggagaaacagaacctgttactgtggctgag
ccacaagagcctccaactgtggaactagatgtttctgtcaagggtggaatacaaatcatg
gctgggaagactctcagaatcccagcggaggtgactggccgtcctgtgcccacaaaagta
tggaccatcgaagaaggggagctagataaagagcgtgttataatagagaatgtcggaacc
aaatctgaactaattatcaagaacgcattgagaaaagaccatggcagatacgtgatcacg
gcaacaaacagctgtggttccaaatttgccgcagtccgggttgaagtgttcgatgtccct
ggcccagttcttgacctcaaaccggttgtaacaaacagaaagatgtgtctgcttaattgg
tccgatccagcagatgatggcggaagtgacatcacagggtttataattgaaaggaaggat
gctaagatgcacacttggagacagcccatcgagactgagagatccaagtgtgacatcaca
ggccttatagagggacaagaatacaagttccgtgtcattgccaagaacaagtttggctgt
gggcctcctgttgaaataggaccaattcttgcagttgatccactaggccctccaacatct
cctgaaaggctcacatacacagaaagaacaaaatccaccatcacacttgactggaaagag
ccacgcagcgatggtggcagtcccattcaaggatatatcattgaaaaacgccgccatgac
aaacccgactttgaaagagttaacaagagactctgcccaaccacatcatttctggttgaa
aatcttgatgaacaccaaatgtatgagttccgtgtcaaagccgtcaatgacgttggtgaa
agtgaaccatctctgcctcttaacgtagtcatacaggatgatgaagtccctcccactatt
aagttgcgcctggctgttcgaggagacactatcaaagttaaggcaggggagccagttaac
atccctgcagacgtgaccggcctccccatgcctaagattgagtggtccaagaatgaaaag
gtgattgataaacctacggatacactgaatataaccaaagaagaagtctcccgaagtgag
gcaaagactgagcttagcatccctaaagcagcccgagaggacaagggcacgtacacaatc
acagcttccaatcgtcttggctccgtattccgcaacgttcatgtggaggtttatgatcgt
ccatctccacccagaaacctcgctgttactgacatcaaagctgagtcttgctatttgacg
tgggatgcccctctagacaatggaggcagtgaaattactcattacatcattgacaagcgt
gatgccagcaggaagaagtccgaatgggaagaagtcactaacactgctgttgagagaaga
tacgggatctggaagcttatccccaatggtcagtacgagttccgagtgagggcagtgaat
aaatatggaatcagtgatgaatgcaaatcagacaaggtcgtcattcaagatccctaccgc
ctccccgggcctcctggaaaaccgaaagtcttagaacgtaccaaaggatctatgcttgtg
agctggacccctcctctggacaacggagggtctccaattactggctactggctagagaag
agagaggaaggtggtacctactggtcacgtgttagcagagcaccaataaccaaagtagga
ctgaagggtgtggaattcaatgttccgcggttgattgaaggcgtcaaatatcaatttaga
gccatggcaataaatgctgcaggaattggccctcccagtgaaccatcagacccagctgtt
gcaggagatcctatataccctcctgggccaccttcttgcccagaggtcaaagataaaaca
aaatcaagcatctcactagcatggaaacctccagccaaagacggtggcagcccaatcaaa
ggctacattgtagagatgcaagaggagggaaccacggactggaagccagtcaatgaaccc
gataaacttctcactgcctgtgaatgtgtggtgcctaatctgaaagagctcaggaagtac
aggttcagagtgaaagctgtcaatgaagctggagagtctgaaccaagtgacacgaccgga
gagatccctgccactgatatccaagaagttccagaggttttcattgacattggcgcacaa
gactgcctggtttgcaaagctggctcacaggtcaaaattcctgctgtgatcaagggacgc
cccacaccaaaatcatcttgggaatttgatggaaaagcaaagaaggcaatgaaggatgga
gttcatgatatacctgaagatgcacagctggagacggccgaaaactcatcggtcatcatt
atcccagagtgtactcgagctcactcgggcaaatacagcatcacagccaagaacaaagca
ggacagaaaactgccaactgcagagttaaagtcatggacgcaccaggccctcccaaagat
ttgaaggtcagtgacatcacaaggggtagttgccgcctctcatggaagatgccagatgat
gatggaggtgataggatcaaaggctacgtcattgagaagaagaccatcgacgggaaagcc
tggacgaaagtcaatccaaattgtggaagcaccacatttgtggtaccagatcttatctct
gagcagcaatacttcttccgtgttcgagcagaaaaccgttttggaattggcccacctgca
gaaaccatccagaggaccactgccagagacccaatatatcctcctgatccccctatcaaa
ctcaagattggtctcataacaaagaacacagtgcacctgtcgtggaaacctccaaagaat
gatggtggctctcctgtcacccattatattgttgagtgtttggcttgggaccctaccggg
aaaaagaaagaagcctggaggcagtgcaataggcgtgatgtggaagaactggagttcacc
gtggaagacctcatagagggaggggaatatgaattcagagtcaaagccgtcaacgaggcc
ggggtcagcaagccttcagccactgttggtcctgtgattgtcaaagaccagacatgccca
ccagccattgagctaaaagaattcatggaagttgaagaaggaactgatgttaacattgtg
gccaaaatcaaaggtgtgccgttcccaactctcacctggttcaaggctccgccaaagaaa
cccgacagcaaagagcctgttgtttatgacacccatgtcaacaaacaggtggtggatgac
acttgcactttagtcattcctcagtctcgccggagtgacactggcttatattctatcaca
gccgtaaacaacctggggacagcatcaaaggagatgagactcaatgtccttggtcgtcct
ggcccccctgtgggacccataaagtttgaatctatttcagcggatcagatgacattatct
tggcttccacctaaagatgacggtgggtctaagattacaaactatgtcattgagaaaaga
gaagccaacagaaagacatgggtacgtgtctccagtgaacctaaagaatgcatgtacaca
attcccaaattgctagaaggccatgaatacgtcttccgaatcatggcccagaataagtac
ggcattggagagccacttgacagtgaacctgagacagcacggaacctcttctctgtccct
ggagctccagataaaccaacagtgagcagcgtcactcgcaactccatgactgtcaactgg
gaagagccggaatatgatggaggctctcctgtgacagggtactggttagaaatgaaagac
accacttcaaagagatggaagagagttaaccgagatcccatcaaagccatgactctaggt
gtttcttacaaagtgactggccttattgaaggatcagactatcagttccgggtatatgca
atcaatgccgctggtgtgggtccagcaagtcttccctcagatccagtgactgctagagat
ccagttgctccccctggtcctccattccccaaagtgacagactggacaaaatcatctgtg
gacttagaatggtctcctccactaaaagatggcggatccaaaatcactggctacattgtt
gagtataaggaagaaggaaaagaagaatgggaaaagggtaaagataaagaagtgaggggg
acaaaactggttgttactggattaaaagaaggagccttctacaaattccgtgtgagagca
gtcaatgttgctggtgttggggaacctggagaagtcacggacgttattgaaatgaaggac
agaattgtgtcgcctgaccttcagcttgatgccagtgtcagagacagaatagtggtccac
gccggaggggtgatccgtatcattgcctatgtatctgggaagccacctcccactgtcacc
tggagtatgaatgaaagagccttgcctcaagaggccgccattgagaccacagcaattagc
tcatccatggtcatcaagaactgccagaggagccaccaaggcgtctactctcttcttgcc
aaaaatgaaggcggagaaagaaagaagacaattattgttgatgtactagatgtcccagga
cctgttggaataccattcctctctgacaacctaaccaatgactcctgcaaactgacatgg
ttctctccagaagatgatggtggctctccaatcaccaattatgtcattcagaagcgggaa
gctgaccgcagggcatggacccctgtgacatacacagtcactcgacaaaatgctactgtt
cagggccttattcaaggaaaatcctactttttccgaattgcagctgagaatagcattggc
atgggcccatttgttgagacaccaaatgcacttgtcattagagacccaataactgtgcca
gagagacctgaggacctggaagtcaaagaagtcactaaaaatactgtgtctttgacttgg
aaccctcccaagtatgatggcgggtcagaaattataaactatgtcctagaaagccgcctc
attggtactgagaagttccacaaagttacaaatgacaacctgcttagcaggaaatacact
gtgaaaggcttaaaagaaggcgatacatatgagtaccgcgtcagtgccgtcaatatcgtt
ggacaaggcaagccatcattttgcaccaagccaatcacttgcaaggatgaactggctcca
cctacacttgacctcgacttcagagataagcttaccgtccgagttggtgaatctttcgcc
ctcactggccgatactcaggcaaaccaaagcctaagattgattggttcaaagatgaagct
gatgtactggaagatgatcgtactcacataaagaccactcccacgacacttgctcttgag
aagacaaaggccaaacgctcagattctgggaaatactgtgtagttgtggagaacagtaca
ggctccaggaaaggtttctgtcaagtcaatgttgttgatcgtcctggaccaccagtagga
cctgtcatttttgatgaggtgaccaaagaatacatggttatttcttggaagccacctcta
gatgatggaggaagtgaaattaccaattatattattgagaagaaggagctcggtaaagac
atctggatgcctgtgacatctgccagtgccaaaactacatgcaaggtccctaaactgctt
gaaggaaaagattacatcttccggattcatgcggaaaatctatatggaataagtgaccct
ctggtgtctgattcaatgaaagccaaagatcgattcagagtccctgatgcacctgagcag
ccagttgtcacagaggtcaccaaagactcggcattagtaacctggaacaagccaaatgac
ggaggaaagcccatcacaaactacatcctggaaaagagggaaactatgtctaaaagatgg
gttcgagttaccaaagagcctattcatccatacactaagtatagggttcctgatcttcta
gaaggatgccagtatgaattccgtgtttctgcagagaatgaaattggtattggagatcca
agtccaccatccaaaccagtctttgctagagacccaattgctaaaccaagtccacctatt
aatcctgaggcaatagatacaacatgtaattcagttgagctaacttggcagccaccacgt
cacgacggtggtagcaagatcctgggttatatcgtggagtaccagaaagttggggatgaa
gagtggagacgagccaatcacactcctgaatcatgccctgaaactaaatataaagtcact
ggcctcagggatggtcagagctacaagttccgagtactggcagtcaacgaggctggtgaa
tcggacccagcccacgttcctgaaccagttctagtaaaggaccgacttgaacctcctgag
cttatacttgatgctaacatggcaagagaacaacacattagagttggtgacaccctaaga
cttagtgccatcatcaaaggtgtgccattccccaaagtaacctggaaaaaagaagacaga
gaggctccaacaaaagcccaaattgatgttactccagttgggagcaagcttgaaatccgt
aatgctgcccacgaagatggtggtatttattccctaactgtggagaatccggcgggtaca
aagacagtctcagtcaaagtattggtcttagataaacctgggccacctagagatctggaa
gtcagtgaaattaggaaagattcttgttacctgacttggaaggaaccactggacgacggt
ggttctgttgtaaccaattatgtggttgagaggaaagatgttgccactgcccagtggtcc
cctctttccaccacgtcaaagaagaagagccatatggctaaacatctgactgagggcaat
cagtacctcttccgagtagctgctgagaaccaatacggacgtggtccttttgttgaaaca
cctaagcccatcaaggctctggatcctctccatcccccagggccacccaaggatctgcac
cacgtagatgtcgacaagactgaagtctctctcgtttggaataagccagatcgtgatggt
ggttctccaatcacaggatacttagtggaatatcaagaagagggtgacaaggactggatc
aagttcaagactgtgaaaaatttagactgtgttgttacaggcttacaacaaggaaagacc
tatagattccgtgtaaaagctgaaaatatcataggtcttggtcttcctgatacaactatc
ccaatagaatgtcaagagaaactagtgcctccatctgtggaattagatgtgaagttaatt
gaagggcttgtggtgaaggctggtaccacagttagattccctgccatcataagaggtgta
cctgttcctactgcaaaatggacaactgatgggactgagattaaaacagatgaccactac
acagttgagactgacagcttctcatccgtgctgaccattaagaattgtttaaggaaggat
actggggaataccaactcacagtttccaatgcagcgggtaccaaaacagtagctgtccat
cttactgttcttgatgtacctggtccaccaacaggtcctattaatatcctggatgtcaca
cctgaatacatgactatctcatggcaaccgcctaaggatgatggaggaagcccagtgata
aattacattgttgagaaacaagatacaaggaaaggtacatggggtgtcgtctctgcagga
agcagtaagctgaagctgaaggtcccacatctccaaaaaggctgtgaatacgttttcaga
gtcaaagcagagaacaagatgggtgtcggtcctccccttgactccatacctactgttgct
aagcacaagttcagtcctccatctcctcctggtaaaccagtggtaactgacattactgag
aatgctgcaacggtgtcttggacactgccaaaatctgatggtggcagtccaataactggc
tattatgtagagcgcagagaaataaccggcaaatgggtgagggtcaacaaaacgcctatt
gctgacctgaagttcagggtgactggactctatgagggaaatacatacgagtttagagtt
tttgctgaaaatcttgcaggtttaagcaatccatcacccagttctgacccaatcaaagct
tgccggcccatcaaaccaccagggccacctataaatcctaagctgaaagacaagagcaaa
gaatctgctgacttggtgtggacaaagcccctcagtgatggtggcagccccattttgggg
tatgtagtagagtatcagaaacctggcacagcgcagtgggataggattaataaagacgaa
ctcatcaggcaatgtgccttccgggtccccggactgattgaaggaaatgagtacagattt
cgcattagagcagctaacattgtgggtgagggagagccaagggagcttgcagaatctgtg
attgcaaaagacatccttcatcccccggaagtggaacttgacgttacatgccgtgatgtc
attaccgtccgggtgggtcaaactatccgcattcttgcccgagtcaaaggcagacctgag
ccagacataacttggtccaaggaaggaaaagtactggtcaaagacaagcgggttgaccta
attcatgatctgcctcgtgttgagctacaaattaaagaagctgtcagagctgaccatggc
aagtatatcatctctgctaagaacagcagtgggcatgcccaagggtcagccattgttaat
gtccttgacagacctgggccttgccagaatctgaaggttagcaacgtaaccaaggaaaac
tgcaccatttcttgggaaaacccactagataatggtggctcagaaattacaaatttcata
gtggaatatcgtaaaccaaatcagaaaggctggtcaatcgttgcctcagatgtcaccaag
agactggtcaaggccaacctgttagccaataatgaatactatttccgtgtttgtgcagag
aataaagtaggtgttgggccaaccattgaaacaaagactccaattttggccatcaatcct
attgacaggccaggggagcctgaaaaccttcatattgcagataaaggaaagacctttgtc
tatctaaagtggcgacggcctgattatgatggtggtagcccgaatctatcatatcatgtt
gagaggagactgaagggctctgcagactgggaaagagtgcacaaaggaagcattaaggaa
acccactacatggttgacaagtgtgttgaaaaccagatttatgagttcagagtacaaact
aagaatgaaggtggagaaagtgattgggtgaggacagaggaagttgttgtgaaggaagat
ttacagaagccagtacttgatctaaaattaagtggggtgctaactgtcaaagcaggggac
accattagactcgaggcaggtgtgagaggcaaaccattcccagaggttgcctggaccaaa
gacaaagatgctacagatttaacaagatcaccaagggtcaagattgataccagtgccgaa
tcatcgaaattctctcttaccaaagccaagcgaagcgatggcggtaaatacgtaatcacc
gcaactaacccagctggcagttttgtggcctatgcgactgtcaatgttttagataaacct
ggtcctgtaagaaacctgaaaatcactgatgtgtccagtgacaggtgtactatccgctgg
gatccaccagaagatgatggcggctgtgaaatccaaaattatatcctagaaaaatgtgag
agcaagagaatggtatggtctacctattctgctaatgtcttgacacccagtgctacagtg
actcgtctcatagaaggaaatgagtatattttcagagttcgtgcagaaaacaaaataggc
acagggcctccaacagaaagtaaaccagtcattgcaaaaaccaagtatgacagacctggc
cgccctgatcctccagaagtcactaaagtaagcaaagaagagatgaccgtggtttggaac
gcccctgaatatgatggtgggaagtctatcacaggatactatttagagaaaaaagaaaag
catgcagtccgctgggtccctgttaacaagagtgccatccctgagcgacgcttgaaagta
cagaatctcctcccagggcacgagtaccagttccgtgtcaaagcagaaaatgaagttggc
attggagaaccaagcttaccatcaagaccagtggtggcaaaagatcccatagaaccacct
gggccaccaaccaatttcaaagtggttgatacaaccaaaagttccataactctcgcatgg
ggaaaaccagtctatgatggtggtgcaccgataattggatatgtcgtagagatgagaccc
aaaatagcagacgcatcacctgacgaaggctggaaaaggtgcaacgctgcagctcaactt
attcgcatggaattcacagtcaccagcttggatgagaaccaggagtacgagttcagggtg
tgtgcccagaatcaagttggcattgggcgccctgcagagctaaaggaagccatcaaacct
aaagaaatcctagagcctccagagattgacttggatgccagcatgagaaaactggtcgta
gtgagagctggctgccctattcgactattcgcaatagtgagaggacgacctgcccccaaa
gtcacatggcgcaaagtgggcattgataatgtggtcagaaaaggacaagtcgatctagtt
gacactatggccttccttgtcatccccaactctacccgtgatgactctggaaaatactcc
ctgacccttgtgaacccagcaggagaaaaggctgtttttgtgaatgtcaaagtactagat
actcctggacctgtggctgatttaaaagtttcagatgtcactaaaacatcatgtcacgtg
tcctgggcacctcctgaaaatgatggtggaagccaagtgacacattatattgtggagaaa
cgtgaggcagaaagaaaaacatggtcaacagttacccctgaagtgaagaaaacaagcttc
aatgtaaccaaccttgtccctgggaacgagtatttcttccgagtaactgctgtcaatgaa
tatggccctggtgtcccgacagacatccccaaacctgtgcttgcatcagatcctctcagt
gagccagatcctccaagaaaactggaggtgaccgaaatgacaaagaacagtgctacactg
gcctggttacctccgttgcgtgatggaggcgctaaaatcgatggctatatcattagttac
agagaagaagaccaacctgcagatcgctggacagagtactcagtggtcaaagacctcagc
cttattgttactggcctaaaggaaggaaagaaatataaatttagagttgcagctagaaat
gctgttggagtcagcatgccaagagaggccgaaggcgtctacgaagcaaaagaacagcta
ttgccaccaaagatcctcatgcctgagcaaatcactatcaaagccgggaagaaacttcga
gttgaggcgcatgtgtatggaaagcctaaccccatctgcaaatggaagaaaggagacgac
gaagttgttacatccagccacctggccatccacaaggcagacggctcctcagttctgatc
ataaaagacgttactagaaaagacagtggttactatagcctcacggcagagaatagctcc
gggtcagacactcagaaaatcaaagttacagtcatggatgctcctgggccccctcagcct
ccatttgacatttctgaaatagatgctgatgcttgctccctgtcttggcacatccctctg
gaggatggaggcagcaacattaccaattacatagtagagaaatgtgatgtaagccgtggc
gattgggtcacagctctagcatcagtcaccaagacttcctgcagggttggaaagctgatc
ccaggccaggagtatatcttccgggtccgagctgaaaacagatttggcatttcagagcct
ctcacatctccaaagatgcttgctaagttcccatttgatgttcctagtgagccaaagaat
gcacgtgtcactaaagtcaacaaagactgcatatttgtcgcgtgggacagaccagacagt
gatggaggaagccccatcactggttacctgattgaacgcaaagaaagaaacagtttgctc
tgggtgaaagctaatgacactattgtccggtcaactgagtatccttgtgctggcctcgta
gaaggtctagaatattcattcagaatctatgctctaaacaaagctgggtccagcccacct
agcaaaccaactgagtatgtgactgcaaggatgccggttgatccaccagggaaacctgaa
gttgttgacgtcaccaagaacagcgcatcgcttatctgggcccggccaaagcatgatgga
ggcagcagaattatcggctattttgtagaggcttgcaaacttcctggtgataaatgggtt
cggtgcaataccacacctcaccagattccccaggaagagtacacagctactgggttagaa
gagaatgctcagtatcagttcagagcgattgccaagactgctgtgaacatcagccagcct
tccgagccttctgatccagtgaccattcttgcagaaaatgttcctccacggatagaactc
agtgttgagatgaagtctttgcttaccgtgaaggctgggactaatgtctgcttggatgct
actgtcttcgggaaaccgatgccaacggtttcttggaagaaagacaccacaccaataaaa
caagccgaaggcataaagatggcaatgaagcggaacttgtgtaccttggagctgttcagt
gtgaaccggaaagactcaggagactataccattactgccgaaaattccagtggttccaaa
tcagccaccattaagctgaaagtactagataagccaggtcctccagcatctgtgaaaatc
aacaagatgtatgcagaccgtgcaatgctgtcctgggaacctcctctcgaggatggaggc
tcagaaatcaccaactacatcattgacaagcgtgaaacaagcaggcccaactgggcccag
gtctctgctactgtgcccatcaccagctgcactgtggagaaacttatagagggccatgaa
taccagttccgtatctgtgccgaaaacaaatacggagtcggcgatcccatcctcactgag
ccagcgattgccaaaaacccatatgacccgcctggacgctgtgaccctcctgtcattagc
aacatcactaaagatcacatgaccgtcagctggaaagccccagcggatgatggtggctca
cctatcaccggatacttggttgaaaagcgggaaactcaggcagtcaactggactaaagtc
aacagaaaacctgttatagaaaggacattaaaagcaacgggtctccaggaaggcacggag
tatgaattccgagttacggctatcaataaagctggacccggcaaacccagtgatgcatcc
aaagccgtgtatgctcaagacccactgtatcctcctggcccgccagctttccctaaagtc
tatgataccacccgtagttctgtgagtctatcatggggcaagccggcctatgatggcggc
agccctatcattggttatcttgtggaagtaaagcgagctgattctgatcactgggtgagg
tgcaatttgccagagaagctccagaagacccgcttcgaggtgactggcctgatggaaaac
accgagtatcagttccgagtgtatgccgttaacaagattgggtacagcgaccccagcgat
gtgccagataaacactgccccaaggacatcctaattccacctgagggagaacttgatgct
gaactaaggaaaacacttatcttacgtgctggagttacaatgagactctacgtgccagta
aaaggacggccacctccaaagattacttggtctaaaccgaacgtcaatctaagagaaagg
attggcctggatataaagtcgacagactttgacaccttcttgcgctgcgaaaatgtgaac
aaatatgatgcaggaaaatatatcttaaccttggagaacagctgcggcaagaaggagtac
actattgtggtgaaagtgctggacactcctggtccacctgtcaatgtgactgttaaggag
gtatccaaggactctgcatatgttacctgggatcctcccattattgatggtgggagcccc
atcataaactatgtggttgagaaacgggatgcagagaggaagtcctggtcgacagtgaca
accgagtgctcgaagacaagcttcagagtctctaacttggaggaggggaaatcctacttc
ttcagagtgtttgccgaaaatgaatacggcatcggggatccgggggagacacgtgatgct
gtcaaagcttctgaaaccccgggacctgtggtcgacctgaaagcactggctataactaag
tcatcttgtaccatcggctggaagaagcctcgaagtgatggcggaagcagaattactggc
tatgtggtggatttcctgacagaagaaaataagtggcaacgggtcatgaaatcactgagc
cttcagtactccacaaaggatctgaaggaggggaaggagtacaccttcagagtgagtgca
gagaatgaaaacggagaaggaaccccaagtgaaattgtggttgtggccaaggacgatgtt
gtggctcccgatcttgacttgaaggatctacctgatctgtgctacttggctaaagaaaac
agcaacttccgtctcaagatccccataaaaggcaaaccagcaccatcggtgtcttggaag
aagggggaagatcccctagcaacagacacaagagtcagtgtcgaatcaactgcagttaac
acaacccttgtagtatatgactgccaaaaatccgatgctggaaaatacacaatcacactc
aagaatgttgctggcaccaaggaaggaactctttctataaaggttgttggcaagcctggc
atccccaccggaccaatcaaatttgatgaagtcacagcagaagccatgaccttgaagtgg
ggtcctccaaaggatgatggaggttctgaaatcaccaactatgtactagagaagagagac
tctgtgaataacaagtgggtgacatgtgcttccgctgtccagaaaaccacctttagagta
accagacttcacgagggcatagaatacaccttcagggtcagtgctgaaaataaatatggt
gtaggagaaggcctaaagtcagagccaattgttgccaaacatccatttgatgtgcctgat
gctcccccacctcccaatattgtggatgtcagacatgattcagtatctctaacatggact
gatcccaaaaagactggtggctcaccaattacagggtatcatattgaattcaaggaaaga
aacagccttctgtggaagagagctaacaagactcctataaggatgaaagattttaaagtg
acaggattaactgaaggtcttgaatatgaattcagagttatggctatcaatctagctgga
gtgggcaagccaagcctgccatcagagccagttgtggcacttgatccaattgatcctcct
ggaaaacctgaggttatcagcgtaacaaggaattcagtgactctcatctggacagaacct
aaatacgatggtggccataaattaacaggatatatcgtggagaagcgggatctaccctct
aagtcttggatgaaagccaaccatgttaatgtcccagactgtgcctttactgtaactgat
cttgttgaaggtggaaaatatgaattccgaatcagagcaaagaatacagcgggtgctatt
agtgctccatcagagagcacaggaaccattatttgcaaggatgaatacgaggcaccaacc
attgtccttgatccaacaattaaagatgggctaacagtcaaggcaggggatagcattgtt
ttaagtgccattagcattctcggcaaaccccttccaaagtcaagctggtccagggcagga
aaagatatcagaccatcagacatagctcaaataacttcaaccccaacatcttctatgctg
acagttaagtatgccacaagaaaggatgctggcgagtataccatcaccgctaccaatcct
tttggcacaaaggaggaacatgtgaaggtatcagtccttgatgtacctggtcccccaggt
cccattgaaatcagtaatgtttcagctgaaaaagcaacacttacttggacacctccctta
gaagatgggggctcaccgattaaagcttatgttcttgagaagagagaaaccagccggctt
ttgtggacagtggtttctgaagatattcaggcatgcagacatgtggtaaccaaactcatc
caaggaaatgaatacctcttccgtgtgtcagcagtaaaccattacggcaaaggagaaccc
gttcagtctgagcctgtcaaaatggtggacagatttggtcctcctggccctcctggaaaa
cccgagatctcaaatgtcaccaagaacactgccactgtcagctggaagaggccaactgat
gatggtggcagcgagatcacaggatatcatgtagaaaggagagaaaagaaaggcctgcgg
tgggtgagagcaaccaaaacaccagtttccgatctcaggtgcaaagtaactggactgcaa
gaaggaaatacctatgagttccgtgtcagtgcagaaaacagagccgggattggtcctccc
agtgacgcctcgaatcctgttctgatgaaagatgttgcatatcccccaggaccaccttca
aatgcacatgtcactgataccaccaagaaatcggcttctttagcatggggcaagcctcat
tatgatggtgggcttgaaatcactggctatgtggtagagcatcaaaaagtaggagatgat
gcctggatcaaagacacaacaggaacagccctcagaatcactcagtttgtggttcctgat
cttcagactaaggaaaaatacaattttagaattagtgccatcaacgatgcaggtgtgggg
gaaccagctgtgattccaaatgttgaaattgtagagaaggaagtggctcctgattttgag
ctagatgctgagctgcgaagaacacttgtggttagggcagggctcagtattaggattttt
gtgccaattaaaggtcgtcctgcacctgaagtgacatggaccaaagataatatcaacctg
aagcaccgagccaacatcgaaaacacagagtcatttactcttctcattattccagaatgt
aacagatatgacactggtaaatttgtgatgaccatcgaaaacccagctgggaagaaaagc
ggcttcgttaacgtcagagtcctagacacaccaggccctgtccttaacctaaggcctaca
gacatcacaaaggacagtgtcaccctacactgggacctacctctgatagatgggggctca
cgtataacaaattatattgtggagaaacgtgaagcaaccaggaaatcctactccacagtc
actactaagtgccataaatgtacatataaagtgactggcttgacagaaggctgtgaatat
ttcttcagagtgatggcagaaaatgaatatggggttggtgagccaacggaaaccacagaa
cctgtgagagcctctgaggcaccgttacccccagatagccttaacattatggacattacc
aagaacacagtcagcctggcgtggcctaagccaaggcatgatggtgggagcaagatcact
ggctatgtgattgaagcccagagaaaagggtctgaccagtggacccacatctcaacagtg
aaagggttagaatgtgtggtgaggaacctaaccgaaggagaggaatataccttccaagtg
atggcggtaaacagtgcaggcaggagtgcccctagagagagcagacctgtcattgtcaaa
gagcagacgatgctcccagagctggatctccgtggcatctatcagaagctagtcattgcc
agagctggtgacaacatcaaagttgaaatcccagtacttggtcgacccaagcccacagtc
acatggaaaaagggagaccaaatccttaaacagacacagagagttaatgttgaaaacaca
gcaacgtcaaccatcttaaatatcaatgagtgtgtcagaagtgacagtggaccctatcca
ttaacagcaaagaacactgtaggagaggttggtgacgttataaccattcaagtccatgat
attccaggaccacctactggacccattaaatttgatgaagtttcatctgactttgtaacc
ttctcttgggagccaccagagaatgatggaggtgtaccaataagcaactatgtagtagag
atgagacagacagacagtactacatgggtggagttagcaacaactgttatacgtactacc
tataaagcaactcgtctgaccacaggagtggagtatcaattccgtgtaagggctcaaaac
agatatggagttggaccgggcatcacatctgcatctgtagttgcaaactatccattcaag
gtgcccgggcctcccggtacccctcaggttactgcagtcaccaaagactccatgacaatc
agctggcatgaaccactttctgatggtggaagccccattttaggatatcacattgaaagg
aaagaacggaatggcatcctctggcagactgtgagcaaagcattagtaccaggcaacatt
ttcaaatcaactggacttaccgatggcattgcttatgaattccgagtaattgcagaaaac
atggcaggcaagagcaagccaagcaagccatctgaaccaatgtttgctttggatcccatt
gacccacccgggaaaccagttcctctaaacattacaagacacacagtggcactgaagtgg
gctaagcctgaatataccggaggctttaaaattactagctatgtggttgaaaagagggac
cttcctaatggacgatggctgaaggccaacttcagcaacattttagagaatgaatttacg
gtcagcggcctaactgaagatgctgcatacgagttccgtgtgattgccaaaaatgctgcc
ggtgccatcagtccaccgtctgagccatcagatgccatcacatgcagggacgacctggag
gcaccaagaataatggtggatgttagatttaaggataccatcacattaaaagctggcgaa
gcattcaagttggaagctgatgtttcaggtcgcccacctccaacaatggaatggactaaa
gatggaaaggagcttgaaggcacagggaaattagaaataaaaattgcagacttctccact
catctgataaacaaggattcctcaagaacggatagtggggcttacatcctgacagcaacc
aatcctggtggctttgccaaacacattttcaatgtcaaagttcttgatagaccgggacca
cctgagggacctttggctgtgtctgatgtgacatcagagaagtgtgtgttgtcatggttg
cctccactggacgatggaggtgccaaaattgatcattacatcgtacagaaacgtgaaacc
agcaggttggcatggacaaatgttgccacagaagtccaagtaacaaagctgaaggttact
aagctcctgaaagggaatgaatacatattccgtgtcatggcagtaaataaatacggggtt
ggagagccacttgaatcagaacctgtgcttgcagtggatccatatggaccacctgaccca
cccaagaacccggaagttacaactatcaccaaggactccatggtcgtctgctgggggcat
cctgactctgatggtggaagtgaaattatcaactacattgtggagcggcgtgataaagct
ggccagcgctgggtaaaatgcaacaaaaaagctctgactgacttaagatttaaagtatct
gggctgacagaaggacatgaatacgagttcagaattatggcagaaaacgcagctggaatc
agtgctccgagtgctaccagcccgttttataaagcttgcgacactgtgtttaaacctggc
ccaccgggtaacccacgtgtccttgatacaagcaggtcgtccatttcaattgcgtggaat
aaacccatttatgatggaggttcagaaatcactgggtatatggttgagattgccctgcct
gaagaagatgaatggcaggttgtcactccaccagctgggctcaaggcaacttcctatacc
atcaccagcctcatagagaatcaggaatataaaatccgcatttatgccatgaattctgag
ggacttggggaacctgcccttgttcccggaactccaaaggcagaagaaagaatgttgcct
ccagagatagaactggatgctgacttacgcaaagttgtcactatacgagcctgctgcacc
ttgaggctctttgttcccatcaaagggagaccagcacctgaggtcaagtgggcccgagag
catggagaatctctggacaaggctagcattgaatccacaagctcttacaccctgcttgtt
gttggaaatgttaacagattcgacagtggcaagtacatactaacggtagaaaacagctct
ggcagcaagtcggcgtttgtcaatgttagagtgctagatacgccaggccctccacagaat
ctaaagataaaggaggtcacaaagacatctgtcacattgacgtgggagcctcctctcctg
gatggaggctcaaaaataaagaactatattgttgagaagcgagagtccacaagaaaggca
tattcaaccgtggcaacgaattgccataagacgtcctggaaggtagaccagctgcaagaa
ggctgcagttactatttccgtgtcctcgctgaaaacgaatatggcattggactgcccgcc
gaaacagctgagtctgtgaaggcatcggagcgacctcttcctccagggaagataactttg
acggatgtcacacgaaacagtgtgtctctctcttgggagaagccagaacatgacgggggc
agccgaattctaggctacattgtagagatgcagagcaaaggcagtgacagatgggccacg
tgtgccacagtgaaagtcacagaagccaccatcaccggcctgatccagggtgaggaatac
tctttccgtgtttcagcgcagaatgaaaagggcatcagtgaccccagacaactgagtgtg
ccagtaattgctaaagaccttgttatcccaccagccttcaaactcctcttcaatacattc
acggtactggcaggtgaagacctgaaaattgatgtaccattcattggacgccctccacca
gctgtcacctggcataaagatgacatacctctgaagcaaacaactagagtgaatgcagag
agcacggaaaacaattctctactgacaataaaggaagcctgccgagaagatgttggacat
tacacggttaaactgactaactcggcaggtgaagccactgaaacccttaatgttatcgtt
cttgacaagccagggcccccaacaggaccagtgaagatggatgaagtgacagcagacagt
gtcactctttcctgggaaccaccaaagtatgatggcggaagctctatcaataattacatt
gtagagaaacgagacacatccacaaccgcctggcaaatcgtgtcagctacggttgcaaga
acaaccataaaggcctgcagactaaagactggctgtgagtatcagttcagaattgcagca
gaaaacagatatgggaagagtacctacctcaactcagagcctgttgttgcccagtaccca
ttcaaagtgccagggccaccgggcacaccattcgtcacgcttgcctccaaagacagcatg
gaggtacaatggcatgagccagtcagtgatggtgggagcaaagtcattggctaccatcta
gagcgcaaggaaagaaatagcatcctctgggtcaagctgaataagacacctattcctcaa
accaagttcaagacaactggccttgaagaaggcattgaatatgaatttagagtgtctgca
gagaacatcgtaggcatcggcaagccaagtaagccatcagaatgttatgctgctcatgac
ccatgcgatccaccaggtcggccagaggcaatcattgtcacaaggaactctgtgactctt
cagtggaagaaacccacctacgatggtggaagcaagatcactggttacattgttgagaag
aaagaattgcctgatggccgctggatgaaagccagttttacaaatatcattgacacccag
tttgaggtaactggcctactggaagatcatagatatgagtttcgagttatagctcgaaat
gctgcaggagttttcagtgagccctcagaaagtacaggggcaatcacagcaagagatgag
gttgagccacccagaataagcatggaccccaaatacagggacacggttgtggttcaagct
ggtgagtcattcaagatcgatgcagatatatatggcaaaccaataccgaccactcagtgg
gtaaagggtgaccaggagctttcaagcacagctcggttagaaattaagagcaccgacttt
gccaccagtctcagtgtcaaagatgcggtacgtgtggatagtggcaattatatcctaaag
gccaaaaacgttgcaggggagaaatcagttactatcaatgtcaaagttctcgatagacca
gggccacctgagggacctgttgctatatcaggggttacagcagaaaaatgtactctagct
tggaaacccccacttcaggatggtgggagtgacatcacaaattacattgtggaaaggcga
gaaaccagccgcctcgtctggactctggttgatgccaatgtgcaaacgctcagctgtaaa
gtcctgaagcttcttgagggcaatgaatatattttccgtataatggctgtgaacaaatac
ggtgttggtgaacctcttgaatctgagtcattgattgccaagaatccatttgtagtccca
gatgcacccaaagctccagaagttacagctgtgaccaaagactcaatgattgttgtatgg
gaaaggccagcgtctgatggtggcagtgagattctaggatatgttctagaaaaacgggac
aaagaaggcataagatggacaagatgccacaagcgtctaattggagagctgcgcctgaga
gtgactggactgttagaaaatcacaattatgaattcagagtctccgctgaaaatgctgct
ggacttagtgaaccaagccccccttctgcttaccagaaggcatgtgaccccatttataag
ccaggccctccaaacaaccccaaagtcatggatgttaccagatcttcggttttcctttct
tggaccaaacctatctatgatggtggctgtgaaatccaaggatacatcgtagaaaaatgt
gatgtgagtgttggtgaatggacaatgtgtacgccaccaactggaatcaataagacaaat
ctagaagtcgagaagttgttggaaaagcatgaatacaacttccggatctgtgccattaat
aaggccggagtaggggagcatgctgatgtccctgggcctgtaatggttgaagaaaaactt
gaagcacctgatatagaccttgaccttgaactaaggaaagtgattaatataagggcaggt
ggttccttaaggctgtttgttcctataaaaggccgtcctacaccagaagtcaagtggggg
aaggttgatggtgatatccgggacgcagctataattgatgtcactagcagcttcacctct
cttgttcttgacaatgtcaatcgatatgatagtggaaaatacactctcacactagaaaac
agcagtggaacaaaatctgcctttgtgacggtaagggtcctggacacaccaagcccacct
gtcaacttaaaagtcacagaaatcaccaaggactcggtatcaattacatgggaacctcct
ttgttggacggaggatcaaaaattaaaaattacattgttgagaaacgagaagccacaaga
aaatcctatgctgcagttgtaacaaactgccataagaattcgtggaaaatcgatcagctc
caagaaggttgcagttactacttcagggttaccgctgagaacgaatacggtattggcttg
cctgcccgcactgcagatccaatcaaggttgcagaagtcccacaacctccagggaaaata
actgtggatgatgtcaccagaaacagtgtctctctcagttggacaaagcccgaacatgac
ggtggcagtaaaatcatccagtatatcgtagaaatgcaagctaaaaacactgataagtgg
tcagagtgtgctagggtgaagtcccttgacgcagttattaccaacctaactcagggagaa
gaataccttttcagagtcattgctgtaaatgaaaaaggaagaagcgaccccaggtccctt
gcggttccaatcatcgccaaagatctggtcatcgagccagacgtgagaccagcattcagc
agttacagtgtacaggttggccaagacttgaaaatagaagtgccaatttctggacgtcct
aaaccaagcatttcctggactaaggatgggatgccattgaagcagaccacaagaatcaat
gttaccgactccctggacctcaccacactcagcattaaagaaactcataaggatgatggt
ggacagtatggaatcacagtttccaatgtggtgggtcagaaaacagcagctattgaaatc
ataactctagataaacctgatcctccaaaagggcctgttaaatttgatgagatcagtgct
gagagcatcacattatcctggaaccctcccttatatacagggggctgtcaaattaccaac
tacattgttcagaaaagagacacaaccaccacagtatgggatgtcgtctctgctactgtt
gccagaacgaccctcaaagtaaccaagctgaaaacgggtacagaataccaattcagaata
tttgctgaaaaccgatacggacaaagctttgctctggagtctgagccagttgtagctcaa
tatccctacaaagaaccaggccctccaggaacgccatttgtcacagccatctccaaagag
tctatggtggtacagtggcatgaaccgatcaataatggtggaagcccagtcataggttac
caccttgagagaaaggaaaggaatagtattttgtggacaaaagtcaacaaaaccattatt
catgacacccagtttaaagcactgaaccttgaagaaggcattgagtatgaatttagagtt
tatgctgaaaatattgttggggtaggcaaggcaagcaagaattctgaatgctatgtagcc
agagacccctgtgacccaccaggtaccccagaagcaataatagttaagagaaatgaaatc
actttacagtggaccaagcctgtgtacgatggtggcagtatgatcacaggttacatcgta
gagaaacgtgatttacccgagggtcgctggatgaaagccagtttcacaaatgtcattgaa
actcaattcaccgtgtcaggtcttactgaagatcaaagatatgaattcagagtcattgca
aagaatgcagctggggcaataagtaaaccctctgacagtactggaccaataactgccaag
gatgaggttgaactcccacgaatttcaatggatccaaaattcagagacacaatagtggta
aatgctggagaaacattcaggcttgaggccgatgtccatggaaaacccctacccaccatt
gagtggttaagaggagacaaggaaattgaagaatctgccaggtgtgaaataaagaacaca
gatttcaaagctttacttattgtaaaagatgccattcgaattgatggtggacagtatatt
ttaagagcctcgaatgttgccgggtctaagtcatttccagtaaatgtgaaagtgctagac
agaccaggaccaccagaagggccagttcaggttactggagtcacagctgaaaagtgcact
ttggcatggtctccaccacttcaagatggtggcagtgacatttctcactacgtggtagaa
aagcgagaaaccagtcgacttgcatggactgtggttgcttcagaagttgtgactaattct
ctgaaagttaccaagctcttagaagggaataaatatattttccgaataatggctgtcaac
aagtacggtgtcggggaacctttggaatctgctccagtactcatgaaaaatccatttgtg
cttcctggaccaccaaagagcttagaagtcacaaacattgccaaagactccatgacagtc
tgctggaatcggccagacagtgatggtggcagtgagatcattggttacattgtggagaag
agagacagaagtggcattcggtggatcaagtgtaacaaacgccgcattacagatttgcga
ctcagggtgacaggattaacagaagaccatgagtatgaattcagagtctctgcagaaaat
gctgctggagttggagaaccaagtcctgctaccgtttactataaggcatgtgatcctgtg
ttcaaacctggcccacccaccaatgcacacgttgtagacaccactaaaaattcaattaca
cttgcctggagcaaacctatctatgatggcggcagtgagatcctgggctacgttgtagaa
atctgtaaagctgatgaagaagaatggcaaatagttactccacagactggcctgagagtc
actcgatttgaaattgccaaactaatcgaacaccaagaatataaaatacgagtttgcgcc
ctcaacaaagttggtttaggtgaggctgcctcagttcctggtacggtgaaaccggaagat
aaactcgaggcacctgaacttgaccttgactctgagttaaggaaagggatcgttgtcaga
gctggtggatctgccagaatccatattccattcaagggtcgtccaacgcctgagatcact
tggtcaaaagaggaaggtgaattcacagataaggtccaaattgagaagggaattaacttc
acccaactctcaatagataactgtgacagaaacgacgccgggaaatacatcctcaagttg
gagaacagcagcggatcaaagtcggctttcgtaaccgtgaaagtacttgacacaccagga
ccgccacagaatctggctgtcaaggaagtgagaaaagactctgtccttctggtatgggag
ccacctatcattgacggtggggcaaaggtcaagaactatgtcatcgacaagcgcgagtcc
actcgaaaagcatatgctaacgtgagtagtaaatgcaataaaacgagcttcagagtcgag
aacctgaccgaaggagccatctactactttagagtcatggcagagaatgaatttggggtt
ggtgttcccacggagacatctgatgctgtgaaagcttctgagcctccttccccaccagga
aaggtcacactcactgacgtgtcccagaccagtgcatcccttatgtgggagaaacccgag
catgatggagggagcagaattctgggctatgttgttgaaatgcagcccaaaggaacagaa
aagtggagcgttgtggctgaatccaaagtctgtaatgcagtggttagtggcctgagctcc
gggcaagaatatcagttccgtgtcaaagcttacaatgagaaaggaaaaagtgacccgaga
gtgcttggcattcctgtcatagccaaggacttgaccatccagcctagttttaagctgcca
tttaatacatatagtgtccaagcgggagaggatctgaaaatagaaattccagtcataggc
agaccaagacctaaaatttcttgggtcaaagatggtgagcctcttaaacagaccaccaga
gtaaatgttgaagaaacggctacttcgactattttacacattaaagaaagcagcaaagat
gacttcgggaaatacagtgtcacagcaacaaacagtgcaggcacagcaacagaaaacctc
agtgttattgttttagaaaagcctggtcctcccgttggaccagtgaagtttgatgaagtt
agtgcagactttgtggtcatatcttgggaacctcccgcctatactggtgggtgccaaatc
agcaactacattgtagagaagcgagatactaccactaccaactggcagatggtgtcagca
acagttgccaggacaaccattaaaataagcaaactgaaaacaggcaccgaataccagttt
aggatttttgctgagaacaggtatgggaaaagcactcccctggattctaagcccgttgtt
gtacaatatccatttaaagagcctggaccacctggaaccccttttgtaacatctatctcc
aaagatcaaatgcttgtgcagtggcatgagccagttaatgatggaggcagcaaagtgact
ggctaccatcttgaacagaaggaaaagaatagcatcctgtgggtcaagttgaataagatc
cccatccaagacaccaaattcaaaacaacggggcttgatgaagggcttgaatatgagttc
agggtttctgccgagaacattgtgggcattggcaagcctagcaaagtgtcagagtgctat
gttgcgcgtgatccgtgtgacccacctggtcgacctgaagccatcgtcattacaagaaac
agcgtcacgctgaaatggaagaaacctgtttatgatggtggcagcaagataacgggttac
atcgtagaaaagaaagaccttcctgacggccggtggatgaaagccagcttcaccaatgtt
gtggaaactgagtttacagtgactgggcttgtagaagaccaaagatatgaatttagagtc
attgcaagaaatgcggctgacaactttagtgagccatctgaaagcagtggcgccatcact
gcaagggatgaaatcgatgcaccaaatgcctcgctggatcctaaatacagagatgtcatc
attgttcatgcaggagagacctttgttctcgaagctgatatccgtggcaaacccatacct
gacatcatatggtcaaaagatgggaacgaactcgaagaaacagcagctaggatggaaatt
aaatctactctgcagaaaacgactctcattgtcaaggactgtatacgcaccgatggggga
cagtataccttgaaactcagcaatgtcgggggcaccaagactatacctattaccgtgaag
gtgctggataggccagggcctcccgaaggacctctgaaagttactggagttacagccgaa
aagtgttacctggcatggaacccacctttgcaagatggtggtgctagtatttcacattac
atcattgaaaagagagagacaagcagactctcctggacccaggtttcaaatgaagtacag
gccctcaactacaaagtcacgaagttgcttcctgggaacgagtatattttccgggttatg
gcagtgaataaatatggaattggagaggccctggagtctgaaccggtgatagcctgtaac
ccatacaagcgtccaggtcctccttcaacacccgaggcctcagccatcaccaaagactct
atggtactaacatggacacgtccagtggatgacggaggtgctgaaattgaggggtacatt
cttgaaaagcgagataaggaaggcatcagatggaccaagtgcaacaagaaaacattaaca
gaccttcggttcagggtgacaggcctcacagaaggccactcctatgaattcagagttgct
gctgagaacgcagctggtgtcggggaacccagtgagccgtccgttttctaccgtgcatgt
gatgccttgtatccaccaggtccaccaagcaaccccaaagtgacagacacctccaggtct
tctgtctccctagcatggaataagccaatttatgatggtggtgcacccgttagaggatat
gtgattgagctcaaaaaagctgcggctgacgaatggactacctgtacgccaccatcggga
ttacaagggaagcagttcacagtgaccaagcttaaggagaatacagagtacaacttccgc
atctgtgctttcaatactgaaggtgtaggtgagcctgcaacgataccaggctccgttgtt
gctcaggagaggatggaagcaccagaaatagaactggatgctgatctcagaaaggtggtc
actctgcgtgcaagtgccactttgcgcctatttgtcactatcaaaggccgcccagaacct
gaagttaagtgggaaaaggctgaaggcattctcacggaaagagcccagatcgaggtgacg
agttcttatacaatgctggtgattgacaacgtgaccagatttgacagtggtagatacaac
ctcaccctagaaaacaacagtggctccaaaacggcttttgtcaatgtcagagttcttgac
tcaccaagcgcacccgtgaatctgaccataagagaagtgaagaaagactcggtgacgctg
tcctgggagccaccacttattgacggtggagcaaagattacaaattatatcgttgaaaaa
cgagaaactacaagaaaagcttacgctaccattacaaacaactgcactaagaatactttc
aaaatcgaaaatctacaagaagggtgttcttattacttccgagtcctggcttctaatgaa
tatgggattggtttgccagccgaaacagcagagcctgtcaaagtgtccgaaccaccactc
ccacctggaagggtaacccttgtagatgtgacccgtaatacagctacgattaagtgggag
aagccagagagcgatggcggcagcaagatcactggttatgttgtggaaatgcagacaaag
ggcagtgaaaagtggagcgcatgcacacaagtgaagactttggagacaactatatctggc
ctaactgcaggggaagagtatgtcttcagggtagctgcagttaatgaaaaaggaagaagc
gacccaagacagcttggggtgccagtcattgcaaaagacattgaaataaagccctccgtt
gagcttccttttaatactttcaacgttaaggctaatgaccaactcaaaattgacatacca
tttaaaggaagacctcaagctaccgtggcctggaaaaaagatggtcaggtccttagagag
acaactagagtcaacgtagcttcctcaaagaccgtaacaaccctatctattaaagaagcc
tcaagggaagatgttggaacttacgaactatgtgtttcaaatactgctggatccataaca
gttcctattactgtcattgtccttgacaggccaggacctccaggacccatacgaattgat
gaagttagttgtgacaatgtgtctatttcttggaatcctccagagtatgatggtggctgc
caaattagcaactacattgttgaaaagagagaaaccacttctacaacgtggcaggtagtt
tcacaagcagtggcaagaacatccattaagatagtccgtctgacaacaggaagtgagtat
cagttccgtgtctgtgcagagaatcggtatggaaagagttcctacagtgagtcctcagcc
gttgtcgctgagtatccattcagccctcctgggcctcctggtactcctaaagttgtgcat
gccacaaaatctaccatggttgtaagctggcaagtaccagttaatgacggagggagccaa
gtgattggctatcaccttgaatacaaagaaagaagcagcattctctggtcaaaagcaaac
aaagtcctcattgcagatactcagatgaaggtctctggtctggatgaggggctgatgtac
gagtatcgtgtatatgctgagaatatcgctggaattggtaaatgcagtaaagcctgtgaa
ccggtccctgcaagagacccttgtgaccctcctggacaacctgaagtcaccaatatcaca
agaaaatcagtgtcacttaagtggtctaaaccacgttatgatggtggagcgaagatcacc
ggatacattgttgaacgcagagagctaccggacggcaggtggctgaagtgcaatttcacc
aacgttcaggaaacatactttgaagtaactgagctaactgaagaccagcgttatgaattc
cgggtttttgcaagaaatgctgctgattcagtcagtgagccatctgaatccactggacct
atcacggtgaaagacgacgttgaggcgccaagaattatgatggatgtcaaattccgagat
gtcatcattgtcaaggccggagaagtccttaagataaatgcagacattgcagggcgacct
ctgccggtaatttcctgggccaaagatggggtagaaattgaagaaagggcaaaaacagaa
attgtctcaacagactatactaccacattaacagttaaagactgtgtaagaagagacact
gggcagtatgtccttacactgaagaatgtggcaggaactcggactatggcagttaactgt
aaagtacttgataagcctggcccgccagcagggccacttgaaataaatggcctcactgct
gagaagtgctccctttcctggggacgtccccaggaagatggcggtgcagatattgattat
tatatcgtagaaaaacgtgaaacaagccgccttgcatggaccatatgtgaagcagagtta
aggacaacatcttgtaaagtgaccaagctactcaaaggcaacgaatatatcttcagagta
actggtgttaataaatatggtgttggtgagcccttggagagcatggccgtgaaggcgcta
gatccattcaccactcctagcccacccacatctttggaaattacatctgtgaccaaagat
tccatgacactttgctggtcaagacctgagactgatggaggcagtgacatctctggatac
ataatcgaaaggcgtgagaaaaacagtctacggtggatgcgtgtgaacaagaagccagtg
tatgatctgagagtgaagtccacaggactccgagaaggatgtgaatatgagtatcgggtt
tttgctgaaaatgctgccggcctgagtcttccaagtgaaacttctcccttggttcgagca
gaagaccctgtgttcttgccatctcctccatctaaacccaaaatagtggactcgggcaag
acaacaatcaccattggctgggttaaacctttgtttgacggtggggctccaataacggga
tataccgtagaatacaaaaagtctgaggaaaccgactggaaagttgccattcagagcttc
agaggcacagaatacacaatgagtgggctaacaacaggagacgagtatgtttttagagtg
aggtcactcaataagatgggtgccagtgaccccagtgatagctccgatccccaggtagcc
aaagagagagaagaagaacctgtatttgacgttgacagtgagatgaggaagaccttgatt
gtcaaggctgggtcctcgtttaccatgacagttcctttcagaggaagaccaatccccaac
gtctcctggagtaagcccgacaccgacctccgcacgagagcgtacatcgactccacagat
tctcgtacattacttactattgagaatgccaacagaaatgattctggaaaatacacgctg
acaattcagaatgtgctgagcgctgcttccatgaccttcgtcgtcaaagtcttagattcc
ccggggcctccagccaatattactgtacgtgaagtaaccaaggaaactgctatgctgtcc
tgggatgttcctgaaaatgatggcggagcaccggtgaagaattaccacatagaaaaacgt
gaggccagcaagaaggcgtgggtgtcggtcactaacaactgcaaccgcctctcttacaaa
gtgaccaacttacaggaaggagctatctactacttccgagtctctggggagaacgagttt
ggtgttggtgtgccagctgagacaaaggaaggagtcaaaataacagaaaaaccaagccca
ccagaaaagcttggtgtaacaagtgtatccaaagacagtgtctcattgagctggctgaag
ccagaacacgacggtggtagcagaatcatacactatgtcgtcgaagcacttgaaaaagga
cagaaaacgtgggttaagtgcgctgtggtgaagacaacccaccacgttgtttccggtctg
agagagagtcatgagtacttcttccgggtctttgcagaaaaccaagctggtctgagtgac
cccagggagctcctgcttcctgtcctcatcaaggaccagctagaaccacccgaaattgat
atgaagaatttcccaagtcacactgtgtatgtaagagctggttccaaccttaaagttgac
attccaatttctggaaaaccattacccaaagtgaccttatcaagagatggtgtaccactg
aaggccaccatgagatttaatactgagattaccgctgagaacctgaccatcaatctcaaa
gaaagtgttaccactgacgctggaagatatgagatcactgctgccaactccagtggaacc
accaaaactttcattaacatcattgtgctggacaggcctggaccccctactggccctgta
gccattagtgatataactgaagaaagtgtgactctcaaatgggagccaccaaagtatgat
ggcggaagccacgtcaccaattacattgtcctgaagagagaaacaagtactgcagtgtgg
tctgaagtgtcagcaacagtagcaagaaccatgattaaagtcatgaaactaaccacagga
gaagaataccaattccgcatcaaggcagaaaatcgcttcggcatcagtgatcatatagat
tcagtgtgtgtggttgtcaaactaccatacactacacctggaccaccatctacaccctgg
gtatctaacgttactcgagaaagcatcactgtgggttggcacgaaccagtgtccaatgga
ggtagtgcagtcacgggctaccacctggaaatgaaagacagaaatagtattttgtggcag
aaagccaacaaaatgatcatccgtacaactcacttcaaagttacaacaatcagcgctgga
cttatttatgaattcagggtgtatgcagagaatgctgctggtatcggaaagcccagtcac
ccatctgaaccagtcttggccattgatgcctgcgaacccccaagaaatgtgcggatcact
gatatctcaaagaactctgtcaacctttcatggcaacaaccagcttttgatggaggaagc
aagattacaggctacattgttgagaggcgcgaccttccagatgggagatggaccaaggct
agcttcaccaatgttattgagactcaattcactgtctctggattgactcagaattcccag
tatgaattccgggtctttgctagaaatgctgttggttctgtcagcaacccatctgaggtt
gtaggccccatcacatgcattgactcttatggtgggcctgtgattgacttgcctctagaa
tatacagaagttgtcaaatatagagcaggtacctccgtgaagctcagagctggtatttcc
ggcaaacccgagcctacgattgagtggtacaaagatgataaagaattacaaaccaatgca
ttggtgtgtgtggaaaatagcactgaccttgcatctatactcatcaaagatgccaaccgc
cttaacagtggaagctatgagttgaaactgaggaatgccatgggttccgcctcagccacc
atcagagtacagatccttgacaaaccaggacctccaggcggaccaattgaatttaagact
gtcactgcagaaaagataactctgctctggaggcccccagctgacgacggtggcgcaaag
atcacgcactacatcgtggaaaaacgggagacaagccgagtcgtgtggtctatggtggct
gaaaatctggaagagtgcatcgttacaactaccaaaattatcaaagggaatgagtacgtc
ttccgagtccgagctgtgaataagtatggaattggcgagccgctagaatctgagccagtt
gtagccaagaatgcctttgttacacctgggcctccaagcatcccagaggtgacaaagatt
accaagaattcaatgactgttgtctgggacaggccaactgtagatggtggcagtgaaata
aatggctatttccttgaaagacgagacaagaagagtctagcgtggcttaaagtattaaag
gagactattcgtgacaccagacaaaaggtgacaggactcacggaaaacagtgactatcag
tatcgagtctgtgctgtaaatgctgctggagtgggtccattctcagaaccatccgacttc
tacaaggctgctgatccaattgatcctccaggaccacctgccaagataagaattgcagac
tcgaccaaatcatccatcacccttggctggagtaagcctgtctatgatggtggcagtgat
gttactggatatgtggttgagatgaaacaaggagatgaagaagaatggaccattgtctct
accaggggagaggtcagaactacagaatatgtggtctctaacctgaaacccggagtcaat
tattatttccaagtatcagcagtaaactgtgccggccaaggagaacctataacaatgact
gaacctgcacaggctaaagatgtccttgaggaaccagaaatcgacctagatgtggctctc
agaacatctgttatagctaaagctggtgaagatgtccaactactgattccctttaaaggc
agaccgccacctactgtcacctggaggaaagatgagaagaatcttggcagcgataccaga
tacagcatccaaaacactgattcgtcttctttgcttgttattcctcaagtcactcgcaat
gatacaggaaaatacatcctgacaatagaaaacggagtaggccaaccaaagtcttccacc
gtgagtgttaaggtgctcgacacaccagctgcctgccagaagttacaggtgaaacatgtt
tccctaggcacagtcacattgctctgggatcctcctctcatcgatggagggtctcccatc
attaactatgtcatcgaaaagagagatgccacgaagagaacatggtctgttgtgtcacac
aagtgttccggcacatcctttaaagtaacagatttatcagagaagactccattcttcttc
agggttcttgcagaaaatgaaattggcattggtgagccttgcgagaccacggagcccgtg
aaggctgctgaggtgccagcacctatccgagatctctcaatgaaagattccacaaagaca
tctgttgtcctgagctggaccaagcctgactttgatggtgggagcatcatcacagactat
ctggtggaacggaaaggcaaaggtgaacaagcatggtcccatgctggcatcagtaagaca
tgtgagattgagattggacaacttaaagagcaatcagtcttggaattccgagtgtctgct
agaaatgagaaaggacagagcgaccctgtcactattgggccacttacagtgaaggagctt
gtaattacacctgaagttgacttgtcagaaatccctggggcacaaatatctgtgagaatt
ggacataacgtacaccttgaattaccttataaaggaaaacccaagccatccatcagttgg
ctgaaagatggcttgccactgaaggaaagtgaatatgttcgtttcagtaagacagaaaac
aaaatcaccttgagtattaagaattcgaagaaagagcatggagggaaatatactgttatt
cttgataatgcagtgtgtagaaactcattccccattacaatcatcaccctcggcccaccg
tcaaagcccaaaggacccattagatttgatgaaatcaaggctgacagcgccatcatgtca
tgggacatacctgaagatgacggaggaggagaaatcacctgttacagcattgagaagcgg
gaagcatcacaaacaaattggaagatggtgtgttcaagtgttgccagaacaactttcaaa
gtttccaatctggtcaaagattctgaataccagtttagagttagagcagaaaatagatat
ggagtcagtgagccacttgcctcaaatatcatcgtggcaaaacaccaattcaggattcct
ggtcctccaggaaagccagtcatctacaatgtaacttcggatggcatgtcactaacttgg
gatgcaccagtttatgatggtggttcagaagttactggattccatgttgaaaagaaagaa
agaaacagcattctttggcaaagggttaacacatcaccaatatctgggagagaatacaga
gctactggcttaatagaagggctggactatcaattccgtgtatatgctgagaattctgct
ggcctgagctcacctagtgacccaagcaagtttacattagctgtttccccagtagaccca
cccggcactcctgactacattgatgtcacccgggaaaccatcacacttaaatggaaccca
ccattacgtgatgggggcagtaagatcgtggcctacagcattgagaagcggcaaggaagt
gaccgctgggtgagatgcaacttcactgacgtcagtgagtgtcagtacacagttacggga
ctcagtcctggagatcgatatgagttcagaataattgcaagaaatgctgttggcactata
agccccccctcacagtcttctggcctcattatgacaagagatgaaaacgttccaccaaca
gtagaatttggccctgagtacttcgatggtcttgttattaagtctggagacagtcttagg
atcaaagctttggttcaaggacgaccggtcccacgagtaacttggttcaaagatggagtt
gaaattgagaggagaatgaacatggaaataactgatgttcttggctctaccagcctcttt
gtcagagacgcaactcgagatcaccgtggtgtttacaccgtggaagccaaaaatgtatct
ggttccacaaaagcagaagttacagtgaaagtacaagatacaccaggaaaagtagtcggg
ccaataagatttactaatattactggtgaaaagatgaccctgtggtgggaggcacctctc
aatgacggctgcgctcctgtcacgcactacatcattgaaaagcgtgaaaccagcagactt
gcttgggcattgattgaggataattgcgaagccctaagttacactgccattaaactaatc
actggcaatgagtatcagttccggatttctgcagttaacaagtttggtgttggcaggcca
cttgagtccgaccccgtggttgctcaaatacaatacaccattccagatgctcccggagtt
ccagaacctagcaatgtcacaggcaacagcattaccctgacttggacgaggccagaatca
gatggtggcagtgagattcaacactacatccttgaaaggagagaaaagaaaagcacaaga
tgggtaaaagtgatcagcaaacgaccaatctctgagacaaggttcaaagtcacaggtctg
gtggaaggcaacgagtatgagttccatgtcatggctgaaaacgctgcgggcataggacca
gcaagtgggatctcaagactcattaaatgcagagagcctgttaacccaccaagtgccccc
tcggtagtcaaagtgacagacacatcaaagacaactgtgagcttggaatgggccaggcca
gtctttgacggcgggatggagataattggatacataatagaaatgtgcaaagctgactta
ggggactggcacaaagtaaacacagagccatgtgtgaaaacaagatacacggtcactgat
ctacaggctggtgaagaatacaaattccgggtcagtgcggtcaatggtgctgggaaagga
gacagctgtgaggtgaccggcacaataaaagcagtcgatcggttatcagctcccgagtta
gacattgatgcaaacttcaagcagactcacattgttagagcgggagttagcattcgtctc
ttcattgcctaccagggtagacccactcctacagcagtatggagcaagcctgactctaac
cttagcatccgggctgatatccacacaacagactccttcagcaccctcaccgtggaaaac
tgcaacagaaatgatgcagggaaatacacactcacggtagaaaacaacagcggtaagaag
tcgataacattcactgtaaaggtgctggactctccaggaccacctggtcccattaccttc
aaagatgtgacccggggatctgctacactgatgtgggacgcccctctccttgatggtggt
gcccggatccatcactatgtgatagagaagcgggaagcgagtcgccgtagctggcaggtt
gtcagtgaaaaatgcactcgccagatcctcaaggtgagtgagctgacagaaggtgttccg
tactatttccgtgtttctgctgaaaatgagtacggtgttggtgaaccctatgaaatgcca
gaaccaattgtagccacagaacagcccgctccacctaggaggcttgatgtcgttgacact
agcaaatcctctgcggtcctagcctggcttaaacccgatcatgatggaggtagtcggatc
actagctacctgcttgaaatgcgacaaaagggatctgacttctgggttgaagctggtcac
accaaacagctgactttcacagtggagcgcctcgttgagaatactgaatatgaattccgg
gtgaaagccaagaacgacgctggctacagtgaacccagggaagccttctcatctgtcatt
atcaaggagcctcaaattgagcccactgctgatctcactggaatcaccaatcagctcatc
acttgcaaagcaggaagcacatttaccattgacgtgccaatcagtggtcgtcctgccccc
aaagtaacatggaagctagaagaaatgagactcaaggagacagatcgaatgagtatcgca
acaacaaaagacaggaccaccctgactgtaaaggacagtatgagaggtgactctggcaga
tacttcctgaccctagaaaacacagccggtgttaaaacatttactatcacagttgtggtc
attggaagaccagggccagtaactggtcccattgaggtctcatctgtctcggctgaatca
tgtgtcctatcatggactgaaccaaaagacgatggaggcactgaaattacaaattatata
gttgaaaagcgcgagtcgggtaccaccgcctggcagcttatcaattctagtgtgaagcgc
acgcagattaaagtcacacacctcacaaaatacaaagaatactgtttccgggtcagctca
gagaatagattcggggtcagcaagcctctggaatcagtgccaatagttgctgaacatcca
tttgttccaccaagtgctcctaccaggcctgaggtctactatgtgtctgccaatgctatg
tcaattcgttgggaagaaccctaccatgatggcggtagtaaaatcgttggctactgggtt
gagaagaaagaacgtaacaccattctttgggtgaaagaaaacaaagtgccgtgcttagag
tgtaactacaaagtgacaggcttggtagaaggactggagtatcagttccgaacatatgca
ctcaatgctgcgggcgtcagcaaggccagtgaagcttcaagacctatcatggctcaaaat
ccagttgatccacctggtaggccagaagtgacagatgtcacaagatcaacagtgtcacta
atttggtctgccccagtgtatgacggaggcagcaaagttgtgggctacatcatagaacgg
aagccagtcagtgaagttggagatggtcgctggctgaagtgcaactataccattgtctct
gataatttcttcactgtgaccgctctcagcgaaggggacacttatgaattccgtgtgttg
gccaagaacgcagcaggcgtaattagcaaaggctctgaatctacaggccctgtaacttgc
cgagatgaatatgctccaccaaaagctgaattggatgccaggttacaaggcgatctggtg
accatcagagcaggttcagatcttgttcttgatgctgctgttggtggcaaacctgaaccc
aaaatcatctggaccaaaggagacaaggaactggatctctgtgaaaaaatttctctacag
tacactggcaagcgagccactgctgtgatcaaatactgtgaccggagtgacagtgggaaa
tacacactgacagtgaagaacgctagtgggaccaagtccgtatctgtcatggtcaaagtt
cttgattctcctggcccatgtggaaaactcactgtcagcagagtgaccgaggagaagtgc
accttagcctggagccttccacaggaagatggaggagcagagataactcactatattgta
gagagacgggagactagcaggctcaattgggtgatcgtggaaggggaatgcctgaccgca
tcctacgtggttaccagactcatcaagaacaatgaatacacattccgcgtgagggcagtg
aacaagtacggcctcggcgtgccagttgagtcagagcctattgtggccagaaactctttc
acgattccatcacaacctggcataccagaagaagttggggctggcaaagagcacatcatt
attcagtggacgaaacctgaatctgatggtggcaatgaaatcagcaactacctcgtcgac
aaacgggagaagaaaagcttgcgctggacccgtgtcaacaaagactacgtggtgtacgac
accaggctgaaggtgaccagcctcatggaaggctgtgattatcagttccgagtgactgcc
gtgaacgctgctggcaacagtgagcccagtgaagcttcaaacttcatctcatgcagagag
ccatcatacacccctgggccaccttctgctccaagagttgtggataccaccaagcgcagc
attagtttggcatggaccaagcccatgtacgacggtggtactgacatcataggatacgtc
cttgaaatgcaagagaaggacacagatcaatggtgccgagtacatacaaacgccacgata
agaaacaacgaattcactgtgcctgaccttaagatgggccagaagtactccttcagggtt
gctgctgtgaacgccaagggtatgagtgactacagtgagacgactgctgaaattgagccc
gtggaaagactagaaataccagatcttgagcttgcagatgatctgaagaagaccgtgatt
gtcagggctggagcctccttgcgcctgatggtgtctgtctctggaagaccttctcctgtc
atcacgtggagcaaaaaaggcattgaccttgcaaatcgggcaattattgacaacacagag
agctactctttactcattgtagacaaagttaatcggtatgatgctggaaaatacacaatt
gaagctgaaaatcagtctggcaagaaatcagcaacggtcctagttaaagtctatgatact
cctggtccctgcccttcagtgagcgttaaagaagtttcgagagattctgtgaccatcact
tgggaaatccccacaattgatggtggtgctccggtcaacaattacattattgagaagcga
gaagccgccatgagggcattcaagacagtaaccaccaaatgcagcaagactctttaccgc
atatctggactcgtcgagggaaccatgtactactttagagtgcttccagaaaacatctat
ggcatcggagagccttgcgaaacatcagacgcagttctagtctcagaagtacctttggtg
cccacaaaactagaagtggttgatgtcaccaaatccactgtgacccttgcttgggagaaa
ccactctatgacggtggaagccgactcaccggatatgttcttgaggcctgcaaagccggc
accgagagatggatgaaagttgtcactttgaaacccacagtcttagagcacactgttatt
tccctgaatgaaggcgagcagtacttgtttagagtgagggctcaaaatgagaaaggtgtg
tcagaaccgagagagatcgtcacaccagtgacagtacaagacctcagagtgttgccaacg
attgacctttccacaatgccccaaaagaccatccatgtcccagctggcagaccaattgag
ctggtgataccgatcactggtcggccgccacctactgcttcctggttctttgctggttct
aaactgagagaatcagagcgtgtcacagttgaaacccacactaaagtcaccaagctaacc
atccgtgaaactactataagagatacgggagaatatacgcttgaactaaagaatgttact
ggaaccacctcagagacaataaaagttattattcttgacaagcctggtccaccaactggg
cccatcaagattgatgaaattgatgccacgtcagttacgatatcctgggaacctcccgaa
ttggatggtggtgctccactgagtggctatgtggtagagcagcgtgatgctcatcgtcca
ggatggctgccagtttctgagtctgtaacaagaccaacgtttaagtttaccagactcacc
gaaggaaatgaatacgtgttccgcgtggctgcaacaaaccgcttcgggattggctcgtac
ttgcagtctgaggtcatagaatgccgaagcagcatcagtattcctggacctccagaaaca
ttacagatatttgatgtctcccgtgatggcatgacacttacatggtatccacctgaagat
gatggtggctcccaagtgactggatatatcgtggaacgtaaagaagtaagagctgatcgg
tgggtccgtgtaaataaagtaccagtgactatgacccggtaccgctccaccggccttatt
gaaggcttagaatatgaacatcgggtcacagccattaatgcaagaggaactggaaaacca
agtcgtccttccaaacccaccgttgccatggatccaattgctccaccaggaaaaccacaa
aatccaagagttacagatacaacaaggacttcagtctccctggcctggagtgttccggaa
gatgaaggtggatctaaagtcacagggtacttgatcgaaatgcaaaaagtagatcaacgt
gaatggaccaaatgtaacaccaccccaaccaagattcgggagtataccctaacacaccta
cctcagggcgctgaatacagattccgtgtcctagcctgtaatgctggtggacctggagaa
cctgctgaggtaccaggaaccgtcaaagtcacagagatgctggaataccctgactatgaa
cttgatgagagataccaggaaggtgtctttgttcgacaaggtggggtcatcaggcttacc
atcccaatcaaaggaaaaccattcccagtatgtaaatggaccaaggaaggccaagacatt
agtaagcgtgccatgattgcaacatcggaaacacatactgagcttgtgatcaaagaagca
gacagaaacgattctggaacttacgacttggttctggaaaacaaatgtggcaagaagacc
gtttacattaaggtcaaggtgataggaagtcccaacactccagaagggccactggaatac
gatgacatacaagcccgctctgtaagggtcagctggagacctcctgctgacgatggtggt
gctgacatcctgggctacatccttgagagaagagaggtacctaaggctgcctggtatacc
attgactccagagtccgaggcacatctctggtggtgaaaggcctcaaagaaaacgtggaa
taccatttccgtgtctcagcagaaaaccagtttggcataagcaaacccttgaaatctgag
gagccagtcataccaaagacaccactgaatccaccagaaccaccaagcaatcctcctgaa
gtacttgatgtgaccaaaagttccgttagcttgtcatggtctcgacctaaagatgacggc
ggctctcgagtgacgggctactacattgagcgcaaggagacatccactgacaagtgggtc
agacacaacaaaacccagataaccaccacgatgtacactgtcaccggcctcgttcccgat
gctgagtaccagttccgcatcatcgcacagaatgacgttggccttagtgagaccagccct
gcttctgaacctgttgtttgcaaagatccctttgataagccaagccaaccaggagaactt
gagattctctcgatatccaaagacagtgtcaccctccagtgggagaaacccgaatgtgat
ggtggcaaagaaatccttggatactgggttgaatacagacagtctggagacagtgcttgg
aagaagagcaataaggaacggatcaaggacagacagttcaccatcggcggtttgctagaa
gctactgaatatgagttccgagtatttgctgagaacgagactgggctcagccgaccacgt
agaacagctatgtctgtcaagactaaactaacatctggagaagccccaggagtgcgcaaa
gaaatggctgatgtgaccaccaaattaggtgaagctgcacaactctcatgccagatagtt
ggaaggccccttcctgacattaaatggtaccggtttggtaaagagctcatacaaagccgg
aagtacaaaatgtcctcagatgggcgcacgcatactctgacagtaatgacagatgaacaa
gaagatgaaggtgtttatacatgtgtagccacaaatgaagtaggagaagtagaaagcagc
agcaagcttcttctgcaagcggcaccacagttccatcctggttacccactgaaagagaag
tattacggggccgtggggtctacgcttcggctccacgttatgtatattggccgcccagta
cctgccatgacttggttccatggccagaaacttttgcaaaactcagaaaaaatcaccatt
gaaaacactgagcactatactcaccttgtcatgaagaatgtccaacgaaagactcatgct
gggaaatacaaggttcagctcagcaatgcctttgggacagtggatgccaccctagatgtg
gaaatacaagataaaccagacaagcctactggacccattgtgattgaagcactactcaag
aactcggtggtgatcagctggaaaccacctgctgatgatggcggctcctggatcaccaat
tacgtggtagagaaatgtgaggccaaagaaggtgctgaatggcaattggtgtcttcagcc
atctcggtgacaacctgcagaattgtgaacctcacagagaatgccggctactatttccgg
gtctcagctcagaacacctttggcatcagtgagccactagaggtcgcctccattgtgatc
atcaagagtccattcgaaaagccaggtgttcctggtaaaccaaccatcactgctgtcaca
aaggattcttgtgttgtggcttggaagccacctgcaagcgatggcggtgcaaagatcaga
aattactaccttgagaggcgcgagaagaagcaaaacaagtggattgctgtgacgacagag
gaaattcgagaaaccgtcttctcagtgcaaaaccttattgaaggtcttgaatatgagttc
cgtgtgaaatgtgaaaacctgggtggagagagtgaatggagtgaaatatcagaacccgtc
actccaaaatccgacgtcccgattcaggctccacacttcaaggaggagctgagaaacctg
aatgtaaggtatcagagcaacgccactctggtctgcaaggtgaccggtcacccaaagcct
attgtgaaatggtacagacaaggcaaagaaattatcgccgatggactcaagtacaggatt
caagaatttaagggcggttaccaccagctcatcattgcaagcgtcacagatgatgatgcc
acggtgtaccaagtcagagccaccaaccaagggggctccgtgtctggcactgcttccttg
gaagtggaagttccagctaagatacacttgcccaagactctcgaaggcatgggagcggtc
catgctctccgaggggaagtggttagcatcaagatccccttcagtggtaagccagacccc
gtgatcacctggcagaaaggacaagatctcatcgacaataatggccactaccaagtgatt
gtcacaagatccttcacgtcacttgtcttctccaatggagtggagagaaaagatgctggc
ttctatgtcgtctgtgctaaaaacagatttggaattgatcaaaagacagtcgaactggat
gtggctgatgtccccgacccacccaggggtgtcaaagttagtgacgtctcacgcgattct
gtcaacttaacatggacagagccagcttctgatggtggtagcaaggtcaccaactacatc
gtggaaaagtgtgcaactactgcagaaagatggctccgagtgggacaggcccgagaaacc
cgttacactgtgatcaacttgtttggaaaaacaagttaccagttccgagtaatagctgaa
aataaatttggcctgagcaagccatcagagccctcagaaccaaccgttaccaaagaagat
aagaccagagctatgaattatgatgatgaggtggatgaaaccagagaggtcaccacgact
aaagcatcacactccaaaactaaagaactctacgagaaatacatgatagctgaagatctg
gggcgtggtgagtttggaattgtccaccgttgcgttgaaacatcctcaaagaggacattc
atggccaaatttgttaaagtcaaaggaaccgatcaggttttagtcaagaaagagatttcc
attctaaacattgctaggcacaggaacatcttatacctccatgaatcatttgaaagcatg
gaagagttagttatgatctttgaatttatatcaggactcgacatatttgaacgcatcaac
acgagcgcctttgagcttaatgaaagagaaattgtaagctatgtccgccaagtctgcgaa
gcactggagttcttacatagccagaatattggccactttgacattcgaccagaaaatatc
atttaccagacaagaaagaactccactattaaaataatagagtttggtcaagcccgtcag
ctgaagccaggagacaactttaggctgctgttcactgcccctgaatactatgcccctgaa
gtccaccagcatgatgttgtcagcactgccacagacatgtggtcgcttggtacattggtg
tatgtgctactgagtggaatcaacccatttttggctgaaactaaccaacagatgattgag
aacatcatgaacgctgaatatacttttgatgaagaagccttcaaagaaattagccttgaa
gcgatggattttgtcgaccggctattggtgaaagagcgaaaatctcgcatgacagcatca
gaggccctgcagcacccatggctgaagcaaaggatcgacagagtcagtactaaagtcatc
agaacactgaaacaccggcggtactaccacaccctgataaagaaagacctcaatatggtt
gtatcagcagcccggatctcctgtggtggtgcaatacgatctcagaggggagtgagcgtg
gctaaagttaaagttgcatccattgaaattggtccggtctctgggcaaataatgcacgcc
attggcgaagaaggcgggtatgtcaaatatgtttgcaagatcgaaaattatgatcagtct
acccaggtgacctggtactttggcgtgagacagctggaaaacagtgagaaatatgaaatc
acctatgaagatggagtggccaccatgtatgtcaaagacatcaccaaatttgatgatggg
acctacagatgcaaagtcgtcaatgactacggtgaagatagctcttacgcagagctgttc
gttaaaggagtgagggaagtttatgactactattgccgccgaaccaagaaagtcaagcgc
agaacagatgcgatgcggctccttgaaaggccaccagaatttaccctgcctctctataac
aagacggcatacgtgggtgaaaatgtccgttttggagtaactattaccgtccacccagaa
cctcgtgtgacgtggtataaatcaggtcagaaaatcaagccaggtgatgatgaaaagaaa
tacacattcgagtctgacaagggtctttatcaattaacaatcaacagcgtgaccacagac
gatgatgctgaatacaccgttgtggcaaggaacaaacatggtgaagacagctgtaaagca
aagctgacggtgactttacatccacccccgacggaaaccacgctcagacccatgttcaag
cggctgctggcaaatgccgaatgccatgaaggccaaagtgtctgctttgagatcagagtt
tctggcatccctgcaccaacattaaaatgggagaaggatggccagccgctgtccctcggg
ccccacattgaaattgtccatgaaggcttagattattatgcactgcatatcagggacact
ttgccggaagacacaggttattacagagtcacggccacaaacacggccggatccaccagc
tgccaggctcacttacaggtagagcggttgcgctacgtaaagcaggaattccagagtaaa
gaggaacgtgagcgccatgtccaaaaacagattgacaagacactgaggatggctgaaatc
ctttctggaactgaaactgtgccattgactcccgtagcccaagaggctctgcgagaagct
gccattctttacaaaccagcagtgagcaccaagactgtcaaaggagaataccgacttcag
acggaggaaaagaaagaggagagaaaactccgcatgccttacgaagtcccagagccccgc
aggttcaaacaagccacagtagaagaagaccagcgcatcaagcagttcgtgcctatgtct
gacatgaagtggtataagaagatccgggatcaatatgaaatgcctgggaaacttgacaga
gttgtccagaaaaggcccaagcgcatccgcctttcaagatgggaacagttctatgtgatg
cctcttcctcgcattactgaccaataccgacctaaatggcggatccccaaactgacccaa
gacgatctggaaatggtgaggccggcccgacggcgtaccccttccccagattatgatctt
tactattatagaaggaggagacgctctctgggtgacatgtcagatgaggaactgctcctc
cccattgatgactacctggcgatgaagagaaccgaggaagagaggctgcgtctggaggag
gagcttgaactgggcttctcggcttcacctcccagccgaagccccccgaggtttgagctg
tctagcctgcgctattcttcaccgccagctcatgtcaaggtggaagacagaagaagagac
ttcaggtactcgacctatcacgtccccacaaaggaggaaaccagcacgagttatgcagag
ctgcgggaacggcatgcccaggcctcatacaggcagccgaagctacggcagagaatcatg
gccgagaaggaggaagaggagctactgcggccagtgacaaccacccagcgtctctcagaa
tacaagagtgagctggactacatgtcaaaagaagaaaagtctaaaaagaaatcaaaacga
cagagacaagtgacagaaataacggaaatcgaagaggaatacgaaatctcaagacgggct
caaagggaatcatcctcctccgtgtccagactactgagacgccgtcgctccttgtctcca
acttatattgagttaatgagaccagtgtctgagctgattcggtcccatccacgacctgct
gaggaatatgaagatgatgcagaaagaaggtctcctactccagagagaactcgcccacgt
tctcccagccctgtgtctagcgagcgatccctctcaagatttgagaggtctgcaagattt
gacatcttctccaggtacgagtccatgaaagctgccttaaaaactcagaagacatcggaa
aggaagtatgaggttttgagtcagcagcctttcacactggaccatgcccctcgaatcaca
ctgcggatgcgctcccacagggttccctgtggccaaaacacacgcttcatcctaaacgtc
cagtcgaagccgactgccgaagttaaatggtaccacaatggtgtagaactccaagagagc
agtaagattcattacaccaacacaagtggggtcctgaccttggagattctggactgccag
actgaggacggtggaacctaccgtgccgtgtgcaccaactacaaaggagaggcatcagac
tacgcaaccctggatgtaactggcggagcttataccacctatgcatcccagcgcagagat
gaggaggtccccaagtcagtcttccctgaactgacaaaaacagaggcatatgcagtctcg
tcgttcaagagaacatctgagctggaagctgcttcttcagtcagggaagtgaagtcacaa
atgacagagacgagggaaagtctctcaacctatgagcattacgcctctgcggaaatgaaa
agcgccacatcagaggaaaagtcactggaagaaaaagccacggtgagaaagattaagaca
acactggcagcaagaattttaaccaagccacgctccataactgtccatgaaggtgagtct
gcgaggttttcctgcgacactgatggggagccggtaccaacagtgacctggctgcgtgaa
ggacaagtggtgagtacttctgctcgccaccaagtgaccaccaccaagtacaagtcgacc
tttgagatttcttcagttcaggcctctgatgagggcaactacagcgtggtagttgaaaac
agcgatgggaagcaagaagcacagttcaccctgaccgtgcaaaaggccagggttattgaa
aaggctgtgacgtcaccacccagagtcaagtccccagagcctcgggtgaagtccccagaa
acagtgaagtctcccaaaagagtgaaatctccagaaccagtaacttctcatccaaaagcc
gtgtcacccacagagacaaagccaacagagaagggtcaacatctcccagtctctgcccca
ccaaagataactcagtccctgaaagcagaagcttctaaagacattgcaaagctgacctgt
gcggttgaaagtagtgcactgtgtgcaaaagaggtcgcctggtataaagatggcaagaaa
ctcaaggaaaatgggcattttcaatttcattactcagcagatgggacctacgaactcaaa
attcacaaccttagcgaatctgattgcggagagtatgtttgtgaggtctctggtgaagga
ggaacttccaaaaccagcttccagtttactggacaatccttcaagagtatccatgagcag
gtgtcaagcatatcagaaactacaaaatcggttcagaaaactgctgagtcagcagaagcc
aagaaatccgaaccaatagctcctgaatcaatttcctcaaagccagtaattgttactggg
ctgcgggatacaacagtttcttcagacagtgttgctaaatttacaattaaagttactgga
gagccccagccaactatcacctggacaaaggatggaaaggctattgcacaaggcagtaaa
tacaaactctctagcaacaaagaagaattcatcttagaaatcctcaagaccgagacatct
gatggcggactttacgcctgtacagtaacaaattctgctggatctgtgtcctcgagctgc
aagctgacaataaaagctgtaaaagacaccgaggcacagaaagtatctacccagaagacc
tccgaagtcacatctcagaagaaagcgagtgcccaagaggaaatttctcaaaaagcccta
acttctgaagaaatcaaaatgtcagaagtaaaatctcatgaaacgctggccatcaaggag
gaagcgtccaaagttctgattgctgaggaggtcaagaggtcagcagcagcctccctggag
aaatccatcgtccatgaagaagtcaccaaaacctcacaggcatccgaagaagtcaaaact
cacgcggagatcaaaacactgtctacccagatgaacataaccaagggccagcgagcgacc
ctgaaagccaacattgctggggccacagatgtgaaatgggtcctgaacggcactgagctt
ccgaactcagaggaatacagatacggggtatctggcagtgaccaaactctcaccatcaaa
caagccagtcacagagaggaagggatcctcagctgcataggcaaaaccagccagggagtt
gtcaagtgtcagtttgacttgaccctgagtgaagaactctcggatgctccaagcttcatc
acacagcccagatctcaaaacattaacgagggacaaaatgttctcttttcttgtgaggtc
agcggggagccgtcccctgaaattgagtggtttaaaaataaccttccaatttccatttct
tcaaatatcagtgtgagtcgctccagaaacgtgtacactcttgaaatccgaaatgcggct
gtaagtgacagcggaaagtacacaattaaggctaagaatttccacggccagtgctctgca
acagcgtccctcacagtgctccctctggtggaagaaccaccgagagaggtggtattgaaa
acgagcagtgacgtgagcttgcacggaagcgtctcgtctcagtcagtccaaatgtctgcc
tctaagcaggaggcatccttcagcagcttcagcagcagcagcgctagcagcatgactgaa
atgaagtttgcgagcatgtctgcccaaagcatgtcttccatgcaagagtcctttgtagaa
atgagttccagcagttttatgggaaaatctagcatgacacaactggaaagctcaaccagt
agaatgctcaaagcaggcggaagaggaattccacctaaaattgaagctcttccctctgat
atcagcatcgacgaaggcaaagtcctaacagtagcctgtgcctttactggggagcctact
ccagaaataacatggtcctgtggtggaaggaaaatccaaaaccaagaacaacaaggaaga
ttccacattgaaaacacagatgacctgaccaccctgatcatcatggacgtacagaaacaa
gatggcggactttataccctaagcttagggaatgaatttggatctgactctgccactgtg
aatattaatatccgttctatgtaa

DBGET integrated database retrieval system