KEGG   Mus musculus (mouse): 22142Help
Entry
22142             CDS       T01002                                 

Gene name
Tuba1a, Tuba-1, Tuba1
Definition
(RefSeq) tubulin, alpha 1A
  KO
K07374  
tubulin alpha
Organism
mmu  Mus musculus (mouse)
Pathway
Phagosome
Apoptosis
Gap junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    22142 (Tuba1a)
  Cell growth and death
   04210 Apoptosis
    22142 (Tuba1a)
  Cellular community
   04540 Gap junction
    22142 (Tuba1a)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     22142 (Tuba1a)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules
    Other tubulins
     22142 (Tuba1a)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    22142 (Tuba1a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   22142 (Tuba1a)
  Exosomal proteins of other body fluids (saliva and urine)
   22142 (Tuba1a)
  Exosomal proteins of colorectal cancer cells
   22142 (Tuba1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
15 F1; 15 55.29 cM
AA seq 451 aa AA seqDB search
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGVDSVEGEGEEEGEEY
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagtgcatctccatccatgttggccaggctggtgtccagatcggcaatgcctgc
tgggagctctactgcctggaacatggcatccagcctgatggccagatgccaagtgacaag
accattgggggaggagatgactccttcaacaccttcttcagtgagacaggagctggcaag
catgtgccccgggcagtgttcgtagacctggaacccacggtcatcgatgaagttcgcacc
ggcacctaccgccagctcttccaccctgagcagctcatcacaggcaaggaggatgctgcc
aataactatgctcgtggccactacaccattggcaaggagatcattgaccttgtcctggac
aggattcgcaagctggctgaccagtgcacaggtctccagggcttcttggttttccacagc
tttggcgggggaactggctctggcttcacctccctgctgatggagcggctctctgtggat
tacggaaagaagtccaagctggagttctccatttacccagccccccaggtttccactgct
gtggttgagccctacaattccatcctcaccacccacaccaccctggagcactctgattgt
gccttcatggtagacaatgaggccatctatgatatctgtcgtagaaacctcgacattgag
cgcccaacctacactaacctaaacaggttgataggtcaaattgtgtcttccatcactgct
tccctcagatttgatggggccctgaatgttgatctgacagaattccagaccaacctggta
ccctaccctcgtatccacttccctctggccacttatgcccctgtcatctctgctgagaaa
gcctaccacgagcagctttctgtagcagagatcaccaatgcctgctttgagccagccaac
cagatggtgaaatgtgaccctcgccatggtaaatacatggcttgctgcctgctgtaccgt
ggtgatgtggttcccaaagatgtcaatgctgccattgccaccatcaagaccaagcgtacc
atccagtttgtggactggtgccccactggcttcaaggttggcattaactaccagcctccc
actgtggtacccggtggtgacctggccaaggtgcagagagctgtgtgcatgctgagcaac
accacagccattgctgaggcctgggctcgcctagatcacaagtttgatctgatgtatgcc
aagcgtgcctttgtgcactggtatgtgggtgagggcatggaggagggtgagttctctgag
gcccgtgaggacatggctgccctagagaaggattatgaggaggttggtgtggattctgtg
gaaggcgagggggaggaagaaggagaggaatactaa

DBGET integrated database retrieval system