KEGG   Mus musculus (mouse): 22145Help
Entry
22145             CDS       T01002                                 

Gene name
Tuba4a, M[a]4, Tuba4
Definition
(RefSeq) tubulin, alpha 4A
  KO
K07374  
tubulin alpha
Organism
mmu  Mus musculus (mouse)
Pathway
Phagosome
Apoptosis
Gap junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    22145 (Tuba4a)
  Cell growth and death
   04210 Apoptosis
    22145 (Tuba4a)
  Cellular community
   04540 Gap junction
    22145 (Tuba4a)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     22145 (Tuba4a)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     22145 (Tuba4a)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    22145 (Tuba4a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   22145 (Tuba4a)
  Exosomal proteins of other body fluids (saliva and urine)
   22145 (Tuba4a)
  Exosomal proteins of colorectal cancer cells
   22145 (Tuba4a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 C3
AA seq 448 aa AA seqDB search
MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGK
HVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLD
RIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGIDSYEDEDEGEE
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgagtgcatttcagtccatgtggggcaggcaggtgtccagatgggcaatgcctgc
tgggagctctactgtctggaacatgggattcagcctgatgggcagatgcccagcgataag
accattggtggaggggacgactccttcaccaccttcttctgtgaaactggagctggaaaa
catgtgcctcgggcagtctttgtggacctggagcctactgtaatcgatgagatccgaaat
ggcccataccgtcagctcttccacccagagcagcttatcactgggaaagaagatgcagcc
aacaactatgcccgtggtcattacaccattggcaaggagatcatcgacccagtgctggac
cggatccgcaagctgtctgatcagtgcacaggacttcagggcttcctagtattccacagc
tttggagggggcaccggctctggcttcacctctctgctgatggagcggctttctgttgac
tatggcaaaaagtccaagctggaattctccatctacccagccccccaagtgtccacggct
gtagtggagccctacaactccatcctgaccacccataccaccctggaacactcagactgt
gccttcatggtggacaacgaagccatttatgatatctgccgccgtaacctagatattgag
cgtccaacctataccaacctcaaccgcctcatcagccaaattgtctcctccatcacagct
tccttgcgctttgatggggccctcaatgtggacctgacagagttccagaccaacctggtg
ccctaccctcgcatccacttccccttggctacctatgcaccagtcatttctgcagagaag
gcctaccatgagcagctgtcagtggcagagatcaccaatgcctgttttgagcctgccaac
cagatggtgaaatgtgaccctcggcacggcaagtacatggcctgctgcctgctgtaccgt
ggagatgtggtgcccaaagatgtgaatgctgccatagctgccatcaagacgaagcgcagc
atccagtttgtggactggtgccccacaggcttcaaggttggcatcaactaccaaccaccc
actgtggtgcctgggggtgacctggccaaggtgcagcgtgctgtgtgcatgctgagcaac
acaaccgccattgctgaagcctgggcccgtctggaccacaagtttgacttgatgtatgcc
aagagggcttttgtacactggtatgtgggtgagggaatggaggagggggagttctctgag
gctcgagaggatatggctgccctggaaaaagattatgaggaagtaggcatcgactcctat
gaggacgaggatgagggagaagagtag

DBGET integrated database retrieval system