KEGG   Mus musculus (mouse): 22145Help
Entry
22145             CDS       T01002                                 

Gene name
Tuba4a, M[a]4, Tuba4
Definition
(RefSeq) tubulin, alpha 4A
  KO
K07374  tubulin alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04210  Apoptosis
mmu04530  Tight junction
mmu04540  Gap junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    22145 (Tuba4a)
  Cell growth and death
   04210 Apoptosis
    22145 (Tuba4a)
  Cellular community - eukaryotes
   04530 Tight junction
    22145 (Tuba4a)
   04540 Gap junction
    22145 (Tuba4a)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     22145 (Tuba4a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     22145 (Tuba4a)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    22145 (Tuba4a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   22145 (Tuba4a)
  Exosomal proteins of other body fluids (saliva and urine)
   22145 (Tuba4a)
  Exosomal proteins of colorectal cancer cells
   22145 (Tuba4a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Motif
Other DBs
NCBI-GeneID: 22145
NCBI-ProteinID: NP_033473
MGI: 1095410
Ensembl: ENSMUSG00000026202
Vega: OTTMUSG00000048543
UniProt: P68368
Position
1; 1 C4
AA seq 448 aa AA seqDB search
MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGK
HVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLD
RIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGIDSYEDEDEGEE
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgagtgcatttcagtccatgtggggcaggcaggtgtccagatgggcaatgcctgc
tgggagctctactgtctggaacatgggattcagcctgatgggcagatgcccagcgataag
accattggtggaggggacgactccttcaccaccttcttctgtgaaactggagctggaaaa
catgtgcctcgggcagtctttgtggacctggagcctactgtaatcgatgagatccgaaat
ggcccataccgtcagctcttccacccagagcagcttatcactgggaaagaagatgcagcc
aacaactatgcccgtggtcattacaccattggcaaggagatcatcgacccagtgctggac
cggatccgcaagctgtctgatcagtgcacaggacttcagggcttcctagtattccacagc
tttggagggggcaccggctctggcttcacctctctgctgatggagcggctttctgttgac
tatggcaaaaagtccaagctggaattctccatctacccagccccccaagtgtccacggct
gtagtggagccctacaactccatcctgaccacccataccaccctggaacactcagactgt
gccttcatggtggacaacgaagccatttatgatatctgccgccgtaacctagatattgag
cgtccaacctataccaacctcaaccgcctcatcagccaaattgtctcctccatcacagct
tccttgcgctttgatggggccctcaatgtggacctgacagagttccagaccaacctggtg
ccctaccctcgcatccacttccccttggctacctatgcaccagtcatttctgcagagaag
gcctaccatgagcagctgtcagtggcagagatcaccaatgcctgttttgagcctgccaac
cagatggtgaaatgtgaccctcggcacggcaagtacatggcctgctgcctgctgtaccgt
ggagatgtggtgcccaaagatgtgaatgctgccatagctgccatcaagacgaagcgcagc
atccagtttgtggactggtgccccacaggcttcaaggttggcatcaactaccaaccaccc
actgtggtgcctgggggtgacctggccaaggtgcagcgtgctgtgtgcatgctgagcaac
acaaccgccattgctgaagcctgggcccgtctggaccacaagtttgacttgatgtatgcc
aagagggcttttgtacactggtatgtgggtgagggaatggaggagggggagttctctgag
gctcgagaggatatggctgccctggaaaaagattatgaggaagtaggcatcgactcctat
gaggacgaggatgagggagaagagtag

DBGET integrated database retrieval system