KEGG   Mus musculus (mouse): 22152Help
Entry
22152             CDS       T01002                                 

Gene name
Tubb3, 3200002H15Rik, M(beta)3, M(beta)6
Definition
(RefSeq) tubulin, beta 3 class III
  KO
K07375  
tubulin beta
Organism
mmu  Mus musculus (mouse)
Pathway
Phagosome
Gap junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    22152 (Tubb3)
  Cellular commiunity
   04540 Gap junction
    22152 (Tubb3)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules
    Other tubulins
     22152 (Tubb3)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    22152 (Tubb3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   22152 (Tubb3)
  Exosomal proteins of colorectal cancer cells
   22152 (Tubb3)
  Exosomal proteins of bladder cancer cells
   22152 (Tubb3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8; 8 E1
AA seq 450 aa AA seqDB search
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYV
PRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRG
LKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEGEMYEDDDEESEAQGPK
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagggagatcgtgcacatccaggccggccagtgcggcaaccagataggggccaagttc
tgggaggtcatcagcgatgagcacggcatagaccccagcggcaactatgtaggggactca
gacctgcagctggagcgcatcagcgtatactacaatgaggcctcctctcacaagtatgtg
cccagggccattctggtggacttggaacctggaaccatggacagtgttcggtctggcgcc
tttggacacctattcaggcccgacaactttatctttggtcagagtggtgctggcaacaac
tgggccaaagggcactatacggagggcgcggagctggtggactcagtcctagatgtcgtg
cggaaagagtgtgagaattgtgactgcctgcagggcttccagctgacacactcactgggt
gggggcacaggctcaggcatgggcacactgctcatcagcaaggtgcgtgaggagtacccc
gaccgcatcatgaacaccttcagcgtggtgccttcacccaaagtgtcggacactgtggtg
gagccctacaacgccaccctgtccatccaccagctagtggagaacacagacgagacctac
tgcatcgacaatgaagccctctacgacatctgcttccgcaccctcaagctggccacaccc
acctatggggacctcaaccaccttgtgtctgccaccatgagtggagtcaccacctccctt
cgattccctggtcagctcaatgccgacctccgcaagctggctgtgaacatggtgccgttc
ccacgtctccacttcttcatgcccggcttcgccccacttacagcccggggcagccagcag
taccgtgccctgacggtgcctgagctcacgcagcagatgttcgatgccaagaacatgatg
gctgcctgtgacccgcgccacggtcgctacctgaccgtggccactgtcttccgtgggcgc
atgtctatgaaggaggtggacgagcagatgctggccatccagagtaagaacagcagctac
ttcgtggagtggatccccaacaacgtcaaggtagccgtgtgtgacatcccaccccgtggg
ctcaaaatgtcatccaccttcattggcaacagcacggccatccaggagctgttcaaacgc
atctcggagcagttcacagccatgttccggcgcaaggccttcctgcactggtacacgggc
gagggcatggatgagatggagttcaccgaggccgagagcaacatgaatgacctggtgtcc
gagtaccagcagtaccaggacgccactgcggaggaggagggggagatgtatgaagatgat
gacgaggaatcggaagcccaggggcccaagtga

DBGET integrated database retrieval system