KEGG   Mus musculus (mouse): 22166Help
Entry
22166             CDS       T01002                                 

Gene name
Txn1, ADF, AW550880, Trx1, Txn
Definition
(RefSeq) thioredoxin 1
  KO
K03671  
thioredoxin 1
Organism
mmu  Mus musculus (mouse)
Brite
Chaperones and folding catalysts [BR:mmu03110]
 Protein folding catalysts
  Protein disulfide isomerase
   22166 (Txn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 B3; 4 31.87 cM
AA seq 105 aa AA seqDB search
MVKLIESKEAFQEALAAAGDKLVVVDFSATWCGPCKMIKPFFHSLCDKYSNVVFLEVDVD
DCQDVAADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEASITEYA
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagctgatcgagagcaaggaagcttttcaggaggccctggccgccgcgggagac
aagcttgtcgtggtggacttctctgctacgtggtgtggaccttgcaaaatgatcaagccc
ttcttccattccctctgtgacaagtattccaatgtggtgttccttgaagtggatgtggat
gactgccaggatgttgctgcagactgtgaagtcaaatgcatgccgaccttccagttttat
aaaaagggtcaaaaggtgggggagttctccggtgctaacaaggaaaagcttgaagcctct
attactgaatatgcctaa

DBGET integrated database retrieval system