KEGG   Mus musculus (mouse): 22173Help
Entry
22173             CDS       T01002                                 

Gene name
Tyr, Oca1, albino, c, skc35
Definition
tyrosinase (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Melanogenesis
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    22173 (Tyr)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    22173 (Tyr)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    22173 (Tyr)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     22173 (Tyr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
7 D3-E1; 7 49.01 cM
AA seq 533 aa AA seqDB search
MFLAVLYCLLWSFQISDGHFPRACASSKNLLAKECCPPWMGDGSPCGQLSGRGSCQDILL
SSAPSGPQFPFKGVDDRESWPSVFYNRTCQCSGNFMGFNCGNCKFGFGGPNCTEKRVLIR
RNIFDLSVSEKNKFFSYLTLAKHTISSVYVIPTGTYGQMNNGSTPMFNDINIYDLFVWMH
YYVSRDTLLGGSEIWRDIDFAHEAPGFLPWHRLFLLLWEQEIRELTGDENFTVPYWDWRD
AENCDICTDEYLGGRHPENPNLLSPASFFSSWQIICSRSEEYNSHQVLCDGTPEGPLLRN
PGNHDKAKTPRLPSSADVEFCLSLTQYESGSMDRTANFSFRNTLEGFASPLTGIADPSQS
SMHNALHIFMNGTMSQVQGSANDPIFLLHHAFVDSIFEQWLRRHRPLLEVYPEANAPIGH
NRDSYMVPFIPLYRNGDFFITSKDLGYDYSYLQESDPGFYRNYIEPYLEQASRIWPWLLG
AALVGAVIAAALSGLSSRLCLQKKKKKKQPQEERQPLLMDKDDYHSLLYQSHL
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgttcttggctgttttgtattgccttctgtggagtttccagatctctgatggccatttt
cctcgagcctgtgcctcctctaagaacttgttggcaaaagaatgctgcccaccatggatg
ggtgatgggagtccctgcggccagctttcaggcagaggttcctgccaggatatccttctg
tccagtgcaccatctggacctcagttccccttcaaaggggtggatgaccgtgagtcctgg
ccctctgtgttttataataggacctgccagtgctcaggcaacttcatgggtttcaactgc
ggaaactgtaagtttggatttgggggcccaaattgtacagagaagcgagtcttgattaga
agaaacatttttgatttgagtgtctccgaaaagaataagttcttttcttacctcacttta
gcaaaacatactatcagctcagtctatgtcatccccacaggcacctatggccaaatgaac
aatgggtcaacacccatgtttaatgatatcaacatctacgacctctttgtatggatgcat
tactatgtgtcaagggacacactgcttgggggctctgaaatatggagggacattgatttt
gcccatgaagcaccagggtttctgccttggcacagacttttcttgttattgtgggaacaa
gaaattcgagaactaactggggatgagaacttcactgttccatactgggattggagagat
gcagaaaactgtgacatttgcacagatgagtacttgggaggtcgtcaccctgaaaatcct
aacttactcagcccagcatccttcttctcctcctggcagatcatttgtagcagatcagaa
gagtataatagccatcaggttttatgcgatggaacacctgagggaccactattacgtaat
cctggaaaccatgacaaagccaaaacccccaggctcccatcttcagcagatgtggaattt
tgtctgagtttgacccagtatgaatctggatcaatggatagaactgccaatttcagcttt
agaaacacactggaaggatttgccagtccactcacagggatagcagatccttctcaaagt
agcatgcacaatgccttacatatctttatgaatggaacaatgtcccaagtacagggatcg
gccaacgatcccatttttcttcttcaccatgcttttgtggacagtatttttgaacaatgg
ctgcgaaggcaccgccctcttttggaagtttacccagaagccaatgcacctatcggccat
aacagagactcttacatggttcctttcataccgctctatagaaatggtgatttcttcata
acatccaaggatctgggatatgactacagctacctccaagagtcagatccaggcttttac
agaaattatattgagccttacttggaacaagccagtcgtatctggccatggcttcttggg
gcagcactggtgggagctgttattgctgcagctctctctgggcttagcagtaggctatgc
cttcagaagaagaagaagaagaagcaaccccaggaggaaaggcagccactcctcatggac
aaagacgactaccacagcttgctgtatcagagccatctgtga

DBGET integrated database retrieval system