KEGG   Mus musculus (mouse): 22224Help
Entry
22224             CDS       T01002                                 

Gene name
Usp10, 2610014N07Rik, UBPO, Uchrp, mKIAA0190
Definition
ubiquitin specific peptidase 10 (EC:3.4.19.12)
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     22224 (Usp10)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   22224 (Usp10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 E1; 8
AA seq 793 aa AA seqDB search
MALHNPQYIFGDFSPDEFNQFFVTPRSSVELPPYSGTLCSIQAEDELPDAGQEHQRIEFG
VDEVIEPSEGLPPTPSYSISSTLNPQAPEFILGCTTSKKIPEAVEKDETYSSIDQYPASA
LALESNSNAEAETLENDSGAGGLGQRERKKKKKRPPGYYSYLKDGGEDSASPATLVNGHA
TSVGTSGEAVEDAEFMDVLPPVMPRTCDSPQNPVDFISGPVPDSPFPRTLGGDARTAGLC
EGCHEADFEQPCLPADSLLRTAGTQPYVGTDTTENFAVANGKILESPGEDTAANGAELHT
DEGADLDPAKPESQSPPAESALSASGAIPISQPAKSWASLFHDSKPSASSPMAYVETKCS
PPVPSPLASEKQMEVKEGLVPVSEDPVAIKIAELLETVTLIHKPVSLQPRGLINKGNWCY
INATLQALVACPPMYHLMKFIPLYSKVQRPCTSTPMIDSFVRLMNEFTNMPVPPKPRQAL
GDKIVRDIRPGAAFEPTYIYRLLTVIKSSLSEKGRQEDAEEYLGFILNGLHEEMLSLKKL
LSPTHEKHSVSNGPRSDLIEDEELEDTGKGSEDEWEQVGPKNKTSITRQADFVQTPITGI
FGGHIRSVVYQQSSKESATLQLFFTLQLDIQSDKIRTVQDALESLVARESVQGYTTKTKQ
EVEVSRRVTLEKLPPVLVLHLKRFVYEKTGGCQKLVKNIDYPVDLEISRELLSPGIKNKN
FKCQRTYRLFAVVYHHGNSATGGHYTTDVFQIGLNGWLRIDDQTVKVINQYQVVKPPADR
TAYLLYYRRVDLL
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atggccctccacaacccacagtatatctttggcgatttcagccctgatgaattcaatcag
ttttttgtgactccccgctcttctgttgagctccctccatacagtgggactctgtgtagc
atacaggctgaagatgaactgccagatgcaggacaggagcaccagaggatcgagtttggt
gtagatgaagtcatcgaacctagtgaggggctgccgccaactcctagctacagtatttca
agcaccttgaacccccaggcacccgaatttatccttggttgtacgacttctaaaaagatc
cctgaagccgttgaaaaagatgagacctacagctccattgaccagtaccccgcctcggcc
ttggctctggaaagcaactctaacgcagaggctgagaccctggagaacgacagtggtgcc
ggcggccttggtcagagggaacggaaaaagaagaagaagcggccccctgggtactacagt
tatttgaaagatggcggtgaggacagtgcttccccagccaccctggtcaacggccatgcc
acctcagtgggcacgagcggcgaggctgtggaggacgccgagttcatggacgtgcttcct
ccagtcatgcccaggacttgtgacagccctcagaatcctgtggacttcatcagtggccct
gtccctgacagtccgttccccaggacactaggaggcgatgccaggactgcagggctgtgt
gagggctgccatgaagctgactttgagcagccctgcctccctgcagacagcctgctaagg
acagctgggacgcagccctacgttggcaccgatactactgagaacttcgcagttgctaat
gggaaaatacttgaatccccgggcgaggacactgctgccaacggggcagaactgcacacc
gacgagggtgcagacctggaccctgcgaagccggagagccagtcacctcctgccgaaagt
gcgctctctgcctctggcgccatccccattagccagcctgcaaagtcctgggctagtctc
tttcatgattctaagccctctgcctcctcacccatggcgtatgtggaaactaagtgttcc
ccccctgtcccatcccccctggcctctgaaaaacagatggaagtcaaagaagggcttgtt
ccagtgtcagaggatcctgtagccataaagattgcagagttattggagactgtaacccta
atacataagccagtgtcattgcaaccccgtgggctgatcaataaaggaaactggtgctac
attaatgccaccctgcaggcattggtggcttgccctccgatgtatcacctgatgaagttc
attcctctgtactcaaaagtgcagcggccttgcacatcaacgcccatgatagatagcttt
gttcggctcatgaatgagttcactaacatgccagtgcctcccaaaccccgccaagctctc
ggggataaaatcgtgagagatatccgcccaggggctgcctttgaacccacatacatatac
agactcctgacagtcatcaagtcgagcctgtctgaaaagggccggcaggaggacgcagag
gagtatctaggtttcatcctcaatggactccatgaagagatgctgagcctgaagaagcta
ctctcacccacgcacgaaaaacactctgtttccaatgggcccagaagcgacttgatagag
gacgaggagctggaagacacgggcaagggcagcgaggacgagtgggagcaagtgggtccc
aagaataagacgtccatcacccggcaggcggacttcgtccagacgcccatcactggcatt
tttgggggacacatcaggtctgtggtctaccagcagagttccaaagagtcagctactctg
caactgtttttcacgctgcagttggacatccagtctgacaagatacgcacagtccaggat
gcgctggagagcttggtggccagggagtctgtccaaggttacaccaccaaaaccaagcag
gaggttgaggtgagccgcagagtgactctggagaagctgccccctgtcctcgtgctccac
ctgaagcgctttgtctatgagaagacaggtggatgccagaagctggtcaagaacattgac
taccctgtggacttggagatcagcagagaactactttctccaggcatcaaaaataaaaat
tttaaatgccagagaacctataggctgtttgcagtggtctaccaccatggcaacagcgct
acaggcggccactacactacggacgtcttccagattgggcttaatggctggctacgaatc
gatgaccaaacggtcaaggttattaaccagtaccaggtggtgaaaccgcctgccgaccgc
acagcctacctcctatattaccgccgcgtggacctgctgtaa

DBGET integrated database retrieval system