KEGG   Mus musculus (mouse): 22225Help
Entry
22225             CDS       T01002                                 

Gene name
Usp5, AA407472, ISOT, ISOT-1, Ucht
Definition
ubiquitin specific peptidase 5 (isopeptidase T) (EC:3.4.19.12)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     22225 (Usp5)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   22225 (Usp5)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   22225 (Usp5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 F2; 6 59.17 cM
AA seq 858 aa AA seqDB search
MAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVER
HFNKTGQRVYLHLRRTRRPKEEDTSAGTGDPPRKKPTRLAIGVEGGFDLTEDKFEFDEDV
KIVILPDYLEIARDGLGGLPDIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHA
FNLKQLDNPARIPPCGWKCSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYRET
GYPLAVKLGTITPDGADVYSYDEDDMVLDPSLAEHLSHFGIDMLKMQKTDKTMTELEIDM
NQRIGEWELIQESGVPLKPLFGPGYTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVDKLEK
IFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPALESGDGEQVPEQKEVQDGIAPRMFKAL
IGKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVFRFLVEEKIKCLATEKVKYT
QRVDYIMQLPVPMDAALNKEELLEYEEKKRQAEEEKVPLPELVRAQVPFSSCLEAYGAPE
QVDDFWSTALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDIS
QLRGTGLQPGEEELPDIAPPLVTPDEPKGSLGFYGNEDEDSFCSPHFSSPTSPMLDESVI
IQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLILPGSSGPGSTSAAA
DPPPEDCVTTIVSMGFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEAAMDISEGRSA
AESISESVPVGPKVRDGPGKYQLFAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCAS
EKPPKDLGYIYFYQRVVS
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctgagtgaagaggcgctgctgtcagtgttaccgacgatccgtgtccccaag
gcgggagaccgggtccataaagacgagtgcgctttctctttcgacacgccggagtctgag
ggtggcctctatatctgcatgaacacattcctgggattcgggaagcagtatgtggagaga
cacttcaacaagacaggccagcgtgtctacctgcacctccggaggacccggcgaccgaaa
gaagaggacaccagtgcaggcactggagacccacctcggaagaagcccacccggctggcc
attggtgttgaaggagggtttgacctcaccgaggacaagtttgaatttgacgaggatgtg
aagattgtcattttgcccgattacctggagatcgctcgggatgggttgggggggcttcct
gacattgtcagagatcgggtgaccagtgctgtggaagccctactttctgctgactcagcc
tctcgaaagcaggaggtccaggcttgggatggggaagtccgtcaggtgtccaagcatgcc
ttcaacctcaagcagttggacaaccctgctcggatccctccctgtggctggaagtgctcc
aagtgcgacatgcgcgagaacctgtggctcaacctgacagacggctccatcctctgtgga
cggcgctacttcgatggcagtgggggcaacaaccatgctgtggagcactacagggagact
ggctaccccttagctgttaagctgggcaccatcaccccggatggagctgacgtgtattct
tacgacgaggatgacatggttctggaccccagcctggcagagcacttgtctcactttggc
atcgacatgctgaagatgcagaagacggacaagacgatgactgagctggagatagacatg
aaccagcggattggtgaatgggagttgatccaggagtcaggcgtgccactcaagcctctg
tttgggcctggttacacgggcatccggaacctgggtaacagctgctatctcaactccgtg
gtccaggtgctcttcagcatccctgactttcagaggaagtatgtggataaattggagaag
atcttccagaatgccccaacggaccccacccaagacttcagcacccaggtggccaagctg
gggcatggccttctctctggagaatactctaagccagcactggagtcaggtgatggggag
caggtaccagaacaaaaggaagttcaagatggcattgcccctcgaatgttcaaggccctc
attggcaagggccaccctgagttctccactaatcggcagcaggatgcccaggaattcttc
ctacatcttatcaacatggtggagaggaattgccggagttctgaaaatccaaatgaagtg
ttccgctttttggtggaagaaaagatcaaatgcctggccacagagaaggttaagtacact
cagcgagttgactacatcatgcagttgcctgtacccatggatgcagcccttaacaaagag
gagcttttagagtatgaagagaagaagcggcaagctgaagaggagaaagtgccactgcca
gaactggttcgggcccaggtgcccttcagctcctgcctggaagcctacggggcccctgag
caggtggacgacttctggagtacagctctacaggcgaagtcggtcgctgtcaagaccacg
cgctttgcctccttccccgactacctggtcatccagatcaagaagttcacctttggctta
gactgggtgcccaagaagctggatgtgtccattgagatgccagaggagctcgatatctcc
cagctgaggggcacagggctacagccgggagaggaggagctgcctgacattgccccaccc
ctggtcactccggatgagcccaaaggtagccttggtttctatggcaacgaagacgaagac
tccttctgctcccctcacttctcctctccgacatcacccatgctggacgaatccgtcatc
atacagttggtggaaatgggcttccctatggatgcctgccggaaagctgtgtactatacg
ggaaacagcggggccgaagcagccatgaactgggtcatgtcacacatggatgatccagat
tttgcaaaccccctcatcctgcctggctccagtgggcctggctccacaagtgcagcagct
gaccccccgccggaggactgtgtgaccaccatagtctccatgggcttctccagggaccag
gccctgaaagctctgcgggccacgaacaatagcttagagcgggctgtagactggatcttc
agccacattgatgacctggacgcagaagctgctatggacatctcagagggacgctcagcg
gctgagtccatctccgagtctgtgccagtgggacctaaagtccgggatggtcctggaaag
tatcagctctttgccttcattagtcacatgggcacatctactatgtgtggtcactatgtc
tgccatatcaagaaggaaggcaggtgggtgatctacaatgaccagaaagtgtgtgcctct
gaaaagccacccaaggacctgggctacatctacttctaccagagagtggtcagctaa

DBGET integrated database retrieval system