KEGG   Mus musculus (mouse): 22234Help
Entry
22234             CDS       T01002                                 

Gene name
Ugcg, AU043821, C80537, Epcs21, GlcT-1, Ugcgl
Definition
(RefSeq) UDP-glucose ceramide glucosyltransferase (EC:2.4.1.80)
  KO
K00720  
ceramide glucosyltransferase [EC:2.4.1.80]
Organism
mmu  Mus musculus (mouse)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Lactosylceramide biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    22234 (Ugcg)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.80  ceramide glucosyltransferase
     22234 (Ugcg)
Glycosyltransferases [BR:mmu01003]
 Glycolipid biosynthesis
  Glycosphingolipid
   22234 (Ugcg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 32.44 cM; 4 B3
AA seq 394 aa AA seqDB search
MALLDLAQEGMALFGFVLFVVLWLMHFMSIIYTRLHLNKKATDKQPYSKLPGVSLLKPLK
GVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVG
INPKINNLMPAYEVAKYDLIWICDSGIRVIPDTLTDMVNQMTEKVGLVHGLPYVADRQGF
AATLEQVYFGTSHPRSYISANVTGFKCVTGMSCLMRKDVLDQAGGLIAFAQYIAEDYFMA
KAIADRGWRFSMSTQVAMQNSGSYSISQFQSRMIRWTKLRINMLPATIICEPISECFVAS
LIIGWAAHHVFRWDIMVFFMCHCLAWFIFDYIQLRGVQGGTLCFSKLDYAVAWFIRESMT
IYIFLSALWDPTISWRTGRYRLRCGGTAEEILDV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgctggacctggcccaggagggaatggccttgttcggcttcgtgctcttcgtg
gtgctgtggctgatgcatttcatgtccatcatctacacccggttacacctcaacaagaag
gcaacagacaaacagccgtatagcaagctccctggtgtctctcttctgaagccactgaag
ggggtggatcctaacctaatcaacaacttggagacattctttgaactggattatcccaaa
tatgaagtactcctttgtgtacaagatcatgatgatccagccattgatgtatgtaagaaa
ttgcttggaaaatacccaaatgtcgatgctagattatttataggtggcaaaaaggttggc
attaaccctaaaattaataatttgatgccagcatatgaagttgcaaaatatgatctcata
tggatttgtgatagtggaataagagtcatcccagacacattaactgacatggtgaatcag
atgacagagaaagtggggttggtccacgggctgccgtatgtagccgacagacaaggcttt
gctgccaccttagagcaggtatattttggaacttcacacccaagatcctatatctctgcc
aatgtaactggcttcaaatgtgtgacggggatgtcttgtttgatgaggaaggatgtgcta
gatcaggcaggagggctcatagcctttgctcagtacattgctgaagattactttatggcc
aaagcaatagccgaccgaggttggaggttttcaatgtctactcaagttgccatgcaaaac
tctggttcgtactcaatttctcagtttcaatccagaatgatcaggtggaccaaattgaga
attaacatgcttcctgctacaataatttgtgagccaatttcagaatgctttgttgccagt
ttaattattgggtgggcagcccaccatgtattcagatgggatatcatggtcttcttcatg
tgccactgcctggcatggtttatatttgactacattcaactcaggggtgtccagggtggc
acactgtgtttttcaaaacttgattatgctgtggcctggttcatccgtgaatccatgaca
atctacattttcctgtcggcattatgggacccgactataagctggagaactggtcgctac
aggttacgctgtggggggacagcagaggagatcctggatgtgtaa

DBGET integrated database retrieval system