KEGG   Mus musculus (mouse): 22236Help
Entry
22236             CDS       T01002                                 

Gene name
Ugt1a2, UDPGT_1-2, Ugt1
Definition
UDP glucuronosyltransferase 1 family, polypeptide A2 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
mmu  Mus musculus (mouse)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    22236 (Ugt1a2)
   00053 Ascorbate and aldarate metabolism
    22236 (Ugt1a2)
   00500 Starch and sucrose metabolism
    22236 (Ugt1a2)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    22236 (Ugt1a2)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    22236 (Ugt1a2)
   00860 Porphyrin and chlorophyll metabolism
    22236 (Ugt1a2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    22236 (Ugt1a2)
   00982 Drug metabolism - cytochrome P450
    22236 (Ugt1a2)
   00983 Drug metabolism - other enzymes
    22236 (Ugt1a2)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    22236 (Ugt1a2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     22236 (Ugt1a2)
Glycosyltransferases [BR:mmu01003]
 Others
  Hydrophobic molecule
   22236 (Ugt1a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
1 D; 1
AA seq 533 aa AA seqDB search
MDTGLCVPLRGISGLLLLLCALPWAEGAKVLVLPMEGSQWLSMRDVVRELHARGHQTVVL
ASEVTVHIKGEDFFTLKTYAFPYTKEEYQQEILSDIEKTFKTQHFVKAFFETTASIRNFF
DLYSNSCIALLHNKMLIQQLNSSFFDVILTDPIFPCGAVLAKYLQIPAVFILRSLSCGIE
YEATQCPNPSSYIPNLLTRLSDHMDFLQRVQNMLYYLVLKYICRLSITPYESLASELLQR
EVSLVEVLSHASVWLFRGDFVLDYPRPIMPNMVFIGGINCVTKKPLSQEFEAYVNASGEH
GIVVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDL
LGHPKTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTA
DDLENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHD
LTWYQYHSLDVIGFLLAIVLTVVFIVFKCCAYGCRKCFGGKGRVKKSHKSKTH
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggacacgggactatgtgtgccccttcgaggaatctcagggctgctgctcctgctgtgt
gccctgccctgggctgaaggtgcaaaagtgctggtgttacccatggagggcagccagtgg
ctgagcatgagggatgttgtgcgggagctccacgcccgaggtcaccagactgtggtcctg
gcttcagaggtgactgtgcacatcaaaggagaagacttcttcaccctcaaaacctatgcc
tttccatataccaaggaagaatatcagcaagaaatactgagcgacattgagaagaccttt
aaaacacaacattttgtgaaggccttttttgaaactacagcatctataagaaactttttt
gacctctactcaaattcttgtatagctttattgcacaataagatgctgatccagcaactg
aattccagtttttttgatgtgatcttaacagaccccattttcccctgtggagcagtactg
gccaagtacctacagattcctgctgtgtttattctgcgttctctttcctgtggcatagaa
tatgaggccacacaatgtccaaatccttcctcttatattccgaacctactcacaaggctt
tctgaccacatggacttcctgcaaagggtccagaacatgctgtactatctggtcctgaag
tacatttgccgtttatcaatcactccctatgaaagcctggcctctgagcttttgcagaga
gaagtatccttagtggaggttctcagccatgcatccgtgtggctgttccgaggggacttt
gtactcgactaccccaggcccatcatgcctaacatggtcttcattgggggcataaactgt
gttaccaagaagcccctctctcaggaatttgaagcctatgtcaacgcctctggggagcat
ggcatcgttgttttctctttgggatccatggtctcagagattccggagaagaaagccatg
gaaattgctgaggctttgggcagaattcctcagacggtcctgtggcgctacaccggaact
agaccatcgaatcttgcaaagaacacaattcttgtcaaatggctaccccaaaatgatctg
cttggtcatccaaagactcgggcattcatcacacactctggctcccatggtatttatgaa
ggaatatgcaatggagttccgatggtgatgatgcccctatttggcgatcagatggacaat
gccaagcgcatggaaactcggggagctggggtgaccctgaatgtccttgaaatgactgct
gatgatttggaaaatgcccttaaaactgtcatcaacaacaagagctacaaggagaacatc
atgcgcctctccagccttcacaaggaccgtcctatagagcctctggacctggctgtgttc
tgggtggaatacgtgatgaggcacaagggggcaccacacctgcgcccggccgcccatgac
ctcacctggtatcagtaccactccttggatgtgattggcttcctcctggccattgtgttg
acagtggtcttcattgtctttaaatgttgtgcctatggctgccggaaatgctttggggga
aaggggcgagtgaagaaatcacacaaatccaagacccattga

DBGET integrated database retrieval system