KEGG   Mus musculus (mouse): 22238Help
Entry
22238             CDS       T01002                                 

Gene name
Ugt2b5, AI118071, M-1, Udpgt-3, Udpgt2b5, Ugt2b17
Definition
(RefSeq) UDP glucuronosyltransferase 2 family, polypeptide B5
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00040  Pentose and glucuronate interconversions
mmu00053  Ascorbate and aldarate metabolism
mmu00140  Steroid hormone biosynthesis
mmu00830  Retinol metabolism
mmu00860  Porphyrin and chlorophyll metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu05204  Chemical carcinogenesis
Module
mmu_M00014  Glucuronate pathway (uronate pathway)
mmu_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    22238 (Ugt2b5)
   00053 Ascorbate and aldarate metabolism
    22238 (Ugt2b5)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    22238 (Ugt2b5)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    22238 (Ugt2b5)
   00860 Porphyrin and chlorophyll metabolism
    22238 (Ugt2b5)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    22238 (Ugt2b5)
   00982 Drug metabolism - cytochrome P450
    22238 (Ugt2b5)
   00983 Drug metabolism - other enzymes
    22238 (Ugt2b5)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    22238 (Ugt2b5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     22238 (Ugt2b5)
Glycosyltransferases [BR:mmu01003]
 Others
  Hydrophobic molecule
   22238 (Ugt2b5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C TetR_C_8 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 22238
NCBI-ProteinID: NP_033493
MGI: 98900
Ensembl: ENSMUSG00000054630
Vega: OTTMUSG00000026780
UniProt: Q8K169 Q3UWB9
Position
5; 5 E1
AA seq 530 aa AA seqDB search
MPGKWISALLLLQISCCFRSVKCGKVLVWPMEFSHWMNIKIILDELVQRGHEVTVLRPSA
YYVLDPKKSPGLKFETFPTSVSKDNLENFFIKFVDVWTYEMPRDTCLSYSPLLQNMIDEF
SDYFLSLCKDVVSNKELMTKLQESKFDVLLSDPVASCGELIAELLQIPFLYSIRFSPGYQ
IEKSSGRFLLPPSYVPVILSGLGGQMTFIERIKNMICMLYFDFWFQMFNDKKWDSFYSEY
LGRPTTLVETMGQAEMWLIRSNWDLEFPHPTLPNVDYVGGLHCKPAKPLPKDMEEFVQSS
GDHGVVVFSLGSMVSNMTEEKANAIAWALAQIPQKVLWKFDGKTPATLGHNTRVYKWLPQ
NDLLGHPKTKAFVTHGGANGVYEAIYHGIPMIGIPLFGEQHDNIAHMVAKGAAVALNIRT
MSKSDVLNALEEVIENPFYKKNAMWLSTIHHDQPMKPLDRAVFWIEFVMRHKRAKHLRPL
GHNLTWYQYHSLDVIGFLLSCVATTIVLSVKCLLFIYRFFVKKENKMKNE
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcctggaaagtggatttctgctctgctgctgctgcagataagttgctgcttcagatct
gtgaaatgtgggaaagtgttggtgtggccgatggaattcagtcattggatgaacataaaa
ataatactggatgaactggtacagagaggccatgaagtcactgttctgagaccttcagct
tactatgttcttgatcccaaaaaatcacctggccttaagtttgaaacttttcctacatct
gtcagtaaagacaatctggaaaattttttcattaagtttgtggatgtgtggacttatgaa
atgccaagggatacatgtttgtcatattctcctttactgcaaaatatgattgatgaattt
tctgattattttctaagtctttgtaaagatgttgtttcaaacaaagagctcatgacaaag
ctacaggaatccaagtttgatgtccttttgtcagatcctgttgcttcctgtggggagctc
atagctgaactgctccagattccttttctgtacagtatccgcttctctccaggctaccaa
attgaaaagtccagcgggagatttctactccctccctcttatgtacctgtaattctgtca
ggattaggtggacaaatgacattcatagagaggataaaaaatatgatatgcatgctttat
tttgacttttggttccagatgtttaatgataagaaatgggactcattttacagtgagtat
ttgggaaggccaaccaccttagttgagacaatgggccaagcagaaatgtggctcattaga
tccaactgggatttggagtttcctcacccaaccttaccaaatgttgactatgttggagga
ctccattgcaaacctgctaaacccttgcctaaggatatggaagaatttgtccagagctct
ggagaccatggtgtggtggtcttttctcttgggtcaatggttagtaacatgacagaagaa
aaagccaacgcaattgcatgggcccttgcccagattccacaaaaggttctttggaaattt
gatggcaaaaccccagcaactttaggacacaataccagagtgtacaagtggctcccccag
aatgacctccttggtcatccaaaaaccaaagcctttgtaactcatggtggggccaatggt
gtctacgaggcgatctatcatggaatccctatgattggcattcctttgtttggagaacag
catgataacattgcccatatggtggccaaaggagcagctgttgcattgaatatcagaaca
atgtcaaagtcagatgtgctcaatgcactggaggaggtcatagaaaatcctttctataaa
aagaatgctatgtggttgtcaaccattcaccatgaccagcctatgaaacccctggacagg
gctgtcttctggattgagtttgttatgcgccacaaaagagccaagcacctgagaccactt
ggacataaccttacctggtaccagtaccactctctggatgtgattggattcctactctct
tgtgtggcaaccactatagtccttagtgtaaagtgcctcttgttcatttaccgattcttt
gtaaagaaagaaaataaaatgaagaatgagtag

DBGET integrated database retrieval system