KEGG   Mus musculus (mouse): 22258Help
Entry
22258             CDS       T01002                                 

Gene name
Usp4, F730026I20Rik, Unp, mKIAA4155
Definition
ubiquitin specific peptidase 4 (proto-oncogene) (EC:3.4.19.12)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     22258 (Usp4)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   22258 (Usp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
9 F2; 9 59.25 cM
AA seq 962 aa AA seqDB search
MAEGRGSRERPDVETQKTELGALMGTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVG
EHNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPAEAWNKLLNWYGCVEGQQPIVRK
VVEHGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERE
TRLWNKYMSNTYEQLSKLDNTIQDAGLYQGQVLVIEPQNEDGTWPRQSLQSKSSTAPSRN
FTTSSKPSASPYCSVSASLIANGDSTNSSGMHSSGVSRGGSGFSASYNCQEPPSPHIQPG
LCGLGNLGNTCFMNSALQCLSNTAPLTEYFLKDEYEAEINRDNPLGMKGEIAEAYAELIK
QMWSGRDTHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFILDGLHEDLNRVKKKPYLEP
KDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLP
LPLKKDRIMEVFLVPADPQCRPIQYRVTVPLMGAISDLCEALSKLSGIAAENMVVTDVYN
HRFHKIFQMDEGLSHITPRDDIFVYEVCNTSMDGSECITLPVYFREKKSRPSSASSGAVL
YGQPLLVSVPKHKLTLESLYQAVCDRISRYIKQPLPDEFLSSPLEPGACNGSRSSYEGDE
EEEMDHQEEGKEQLSEVEGSGEDDQGDDHSESAQKVKGQPRHKRLFTFSLVNSCGTADIN
SLATDGKLLKLNSRSTLAIDWDSETRSLYFDEQESEACEKHLSMSQPQKKKKAAVALREC
IELFTTMETLGEHDPWYCPTCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDTV
VEFPVRALNMSEFVCDRSARPYVYDLIAVSNHYGAMGVGHYTAYAKNRLNGKWYYFDDSS
VSLASEDQIVTKAAYVLFYQRRDDECSSTSSLGSFPGSDGGVKLSSSHQGMGDEEAYNMD
TN
NT seq 2889 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggccggggcagccgtgagcgaccggatgtggagacccagaagacggagctc
ggagccttgatggggaccacgctccaacgtggggcgcagtggtatcttattgacagccgg
tggttcaagcagtggaagaagtatgtgggctttgacagctgggacatgtacaatgtcggg
gagcataacctgtttcctggacctattgacaactccggactcttctcagatcctgagagt
cagaccttgaaggagcacttaatcgatgagctggactatgtgctggtcccagccgaagcc
tggaataaattgctgaattggtatggctgtgtggagggccagcagcctattgtcagaaaa
gttgtggagcatggcctgtttgtcaagcactgcaaagtggaagtgtatttgctggagctg
aagctctgtgagaacagtgaccccaccaatgtgctaagttgccattttagcaaagcagac
accattgcaactattgagaaggagatgaggaagctcttcaacatccctgcagaacgtgaa
acacggctttggaacaaatacatgagcaacacctatgagcagttgagcaagctagacaac
actatccaggatgctgggctgtaccagggtcaggtgctagtaattgagccccaaaatgaa
gatggcacatggccccggcagagcctgcagtcaaaatcaagcactgcacctagcagaaat
ttcactacctcttcaaaaccatccgcaagtccctattgctcagtgtctgcctctctcatt
gcaaatggtgatagcactaacagctctgggatgcacagctccggtgtcagcaggggtgga
tctggcttctctgcttcgtataattgccaggagcccccatcacctcatatacagcctggc
ctctgtggacttggaaacctggggaacacttgcttcatgaactctgctctgcagtgcctg
agcaacactgccccactgactgagtactttctcaaagatgagtatgaggccgagatcaac
cgagacaaccctctggggatgaaaggggagattgcagaggcctatgcagagctcatcaag
cagatgtggtctggaagggacactcacgtggcaccacggatgttcaagacgcaagtggga
cgttttgcccctcagttttctggctaccaacagcaagactcccaggagctgctagccttt
attctagacggactgcacgaggacctgaaccgcgtaaagaagaagccttacctggagccc
aaggacgccaatgggcgaccagatgcggtggtagcaaaggaagcctgggaaaaccacagg
ctgaggaatgattctgtgattgtggatactttccatggccttttcaaatcgactttggtt
tgcccagaatgtgctaaagtttctgtgacctttgacccattttgctatctaactctccca
ctgcctttgaagaaggatcggattatggaggtcttcctggttcctgctgaccctcagtgc
agacctatccagtaccgtgtgactgtgccattgatgggggccatttctgacctgtgtgaa
gcactctccaagctgtctggcattgctgcagaaaatatggtggtcactgatgtatataat
caccgcttccacaaaattttccaaatggatgaaggtttaagccacatcacgcctcgagat
gacatttttgtgtatgaggtctgcaacacgtccatggatggctcagagtgtatcactctt
ccagtctacttcagagagaagaagtccaggccgtcgagtgcttcctcgggggctgtgctc
tatggacagccccttcttgtctctgtccctaagcataagctaaccctagagtctttgtac
caggctgtttgtgatcgtatcagccgctacataaaacagcctttgcctgatgagtttctc
agctcacccttagagcctggggcctgcaatggctctaggagtagctatgaaggagatgaa
gaggaagaaatggatcatcaagaggaaggaaaagagcagctttccgaagtggaaggcagt
ggtgaggacgatcagggagatgaccatagcgagagcgcccaaaaggtgaaaggccagccg
aggcacaagaggctctttaccttcagcctcgtgaactcctgtggaactgctgatatcaat
tcactggcaactgacgggaaactcctcaaactcaactctcgatccacactggccattgac
tgggacagtgagacccgaagcctttactttgatgagcaagaatctgaggcctgtgagaag
cacctgagcatgtcacagccgcagaagaagaagaaggcggcagtagccctgcgagagtgc
atcgagctcttcaccaccatggagacccttggggagcatgacccctggtactgtcccacc
tgtaagaagcaccagcaggcaacaaagaagtttgacttgtggtctttgcccaagatcctg
gtggttcacctcaagcgtttctcctataacagatactggcgggataaacttgacaccgtg
gtggagttcccagtcagagctctgaacatgtccgagtttgtctgtgaccggtcagcaagg
ccttatgtttatgacctaattgctgtgtccaatcactatggagccatgggggttggtcac
tacactgcatatgcgaagaacagactgaacgggaaatggtattactttgatgatagcagt
gtgtccctggcctctgaggaccagatagtgacgaaagccgcctacgtgttgttctatcag
cgtcgggatgacgaatgctccagcacatcttcgctcggcagtttccccggttctgatgga
ggggtgaagctgagcagctcacaccagggcatgggggatgaggaggcttacaacatggac
accaactga

DBGET integrated database retrieval system