KEGG   Mus musculus (mouse): 22259Help
Entry
22259             CDS       T01002                                 

Gene name
Nr1h3, AU018371, LXR, RLD1, Unr1
Definition
(RefSeq) nuclear receptor subfamily 1, group H, member 3 (EC:3.4.13.9)
  KO
K08536  
liver X receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
PPAR signaling pathway
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    22259 (Nr1h3)
 Human Diseases
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    22259 (Nr1h3)
   04931 Insulin resistance
    22259 (Nr1h3)
  Infectious diseases
   05160 Hepatitis C
    22259 (Nr1h3)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    22259 (Nr1h3)
Nuclear receptors [BR:mmu03310]
 1. Thyroid hormone like
  1H. Liver X receptor like receptor
   22259 (Nr1h3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2 E1; 2 50.52 cM
AA seq 445 aa AA seqDB search
MSLWLEASMPDVSPDSATELWKTEPQDAGDQGGNTCILREEARMPQSTGVALGIGLESAE
PTALLPRAETLPEPTELRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFF
RRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQ
EEEQAQATSVSPRVSSPPQVLPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPIAP
DPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLET
SRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAI
SIFSADRPNVQDQLQVERLQHTYVEALHAYVSINHPHDPLMFPRMLMKLVSLRTLSSVHS
EQVFALRLQDKKLPPLLSEIWDVHE
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgtggctggaggcctcaatgcctgatgtttctcctgattctgcaacggagttg
tggaagacagaacctcaagatgcaggagaccagggaggcaacacttgcatcctcagggag
gaagccaggatgccccagtcaactggggttgctttagggatagggttggagtcagcagag
cctacagccctgctccccagggcagagaccctcccagagccgacagagcttcgtccacaa
aagcggaaaaagggcccagcccccaaaatgctggggaacgagctgtgcagtgtctgtggg
gacaaagcctctggcttccattacaacgtgctgagctgcgagggctgcaagggattcttc
cgccgcagtgtcatcaagggagcacgctatgtctgccacagcggtggccactgccccatg
gacacctacatgcggcggaaatgccaggagtgtcgacttcgcaaatgccgccaggcaggc
atgagggaggagtgtgtgctgtcagaagaacagatccgcttgaagaaactgaagcggcaa
gaagaggaacaggctcaagccacttcggtgtccccaagggtgtcctcacctcctcaagtc
ctgccacagctcagcccagagcagctgggcatgatcgagaagctggtggctgcccagcaa
cagtgtaacaggcgctccttctcagaccgcctgcgcgtcacgccttggcccattgcaccc
gaccctcagagccgggaagcccgacaacagcgctttgcccactttactgagctggccatc
gtgtccgtgcaggagattgttgactttgccaaacagctccctggcttcctacagctcagc
agggaggaccagatcgccttgctgaagacctctgcaatcgaggtcatgcttctggagacg
tcacggaggtacaaccccggcagtgagagcatcaccttcctcaaggacttcagttacaac
cgggaagactttgccaaagcagggctgcaggtggagttcatcaaccccatctttgagttc
tccagagccatgaatgagctgcaactcaatgatgctgagtttgctctgctcattgccatc
agcatcttctctgcagaccggcccaacgtgcaggaccagctccaagtagagaggctgcaa
cacacatatgtggaggccctgcacgcctacgtctccatcaaccacccccacgacccactg
atgttcccacggatgctaatgaagctggtgagcctccgtactttgagcagcgtccattca
gagcaagtgtttgcccttcgcctgcaggacaaaaagcttccccctctgctgtctgagatc
tgggatgtccacgagtga

DBGET integrated database retrieval system