KEGG   Mus musculus (mouse): 22276Help
Entry
22276             CDS       T01002                                 

Gene name
Uros, AI415298, Uros3
Definition
uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mmu  Mus musculus (mouse)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    22276 (Uros)
Enzymes [BR:mmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     22276 (Uros)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 F3; 7 77.26 cM
AA seq 265 aa AA seqDB search
MKVLLLKDAKEDDSGLDPYIQELRLCGLEATLIPVLSFEFMSLPSLSEKLSHPEGFGGLI
FTSPRAVEAVKLCLEKDNKTEAWEKSLKDRWNAKSVYVVGSATASLVNKIGLDAEGAGSG
NAEKLAEYICSKPSSELPLLFPCGTIKGDTLPKMLKDKGIPMESMHVYQTVPHPGIQGSL
KSYYEDQGIPASITFFSPSGLKYSLEYIQALSGSSFDQIKFIAIGPSTTRAMAAKGLPVS
CTAESPTPQALAAGIRNVLKPNHCC
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttctcttactaaaagacgccaaggaggatgacagcggcctggatccatatatc
caggagctgcgattgtgtggcctagaagccacactgattcctgtgctgtcatttgagttt
atgtctctccccagtttgtcagaaaagctgtctcatcctgaaggctttggaggactcatt
ttcaccagccccagggcagtggaagcagtgaagctgtgtttggagaaggacaataaaact
gaagcctgggagaagtctctgaaagacagatggaatgccaagtctgtgtacgtggttgga
agtgccaccgcttctctagtgaataaaattggtctggatgcagaaggagcgggcagtgga
aatgcagaaaagcttgctgaatatatttgctcaaagccatcttcagagctgcctcttctc
tttccgtgtggaactatcaaaggagatactcttccaaaaatgctcaaggacaaagggatc
cccatggaaagcatgcatgtctatcagacagttccacaccctgggatccaagggagcctg
aagagctactatgaagatcagggtatcccagccagcatcacgtttttcagtccctccggc
cttaaatacagcctcgagtatattcaggcgttatctggcagcagctttgaccagattaag
tttatagccattggccccagtacaacccgtgctatggctgctaagggcctgcctgtgagc
tgcactgcagagagccccacaccacaagccctggctgcaggcatcaggaatgtgctgaag
ccaaaccactgttgctga

DBGET integrated database retrieval system