KEGG   Mus musculus (mouse): 22276Help
Entry
22276             CDS       T01002                                 

Gene name
Uros, AI415298, UROIIIS, Uros3
Definition
(RefSeq) uroporphyrinogen III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00860  Porphyrin and chlorophyll metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    22276 (Uros)
Enzymes [BR:mmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     22276 (Uros)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-GeneID: 22276
NCBI-ProteinID: NP_001289014
MGI: 98917
Ensembl: ENSMUSG00000030979
Vega: OTTMUSG00000025682
UniProt: P51163 Q3UG55 Q3UKR3
Position
7 F3; 7 77.26 cM
AA seq 265 aa AA seqDB search
MKVLLLKDAKEDDSGLDPYIQELRLCGLEATLIPVLSFEFMSLPSLSEKLSHPEGFGGLI
FTSPRAVEAVKLCLEKDNKTEAWEKSLKDRWNAKSVYVVGSATASLVNKIGLDAEGAGSG
NAEKLAEYICSKPSSELPLLFPCGTIKGDTLPKMLKDKGIPMESMHVYQTVPHPGIQGSL
KSYYEDQGIPASITFFSPSGLKYSLEYIQALSGSSFDQIKFIAIGPSTTRAMAAKGLPVS
CTAESPTPQALAAGIRNVLKPNHCC
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttctcttactaaaagacgccaaggaggatgacagcggcctggatccatatatc
caggagctgcgattgtgtggcctagaagccacactgattcctgtgctgtcatttgagttt
atgtctctccccagtttgtcagaaaagctgtctcatcctgaaggctttggaggactcatt
ttcaccagccccagggcagtggaagcagtgaagctgtgtttggagaaggacaataaaact
gaagcctgggagaagtctctgaaagacagatggaatgccaagtctgtgtacgtggttgga
agtgccaccgcttctctagtgaataaaattggtctggatgcagaaggagcgggcagtgga
aatgcagaaaagcttgctgaatatatttgctcaaagccatcttcagagctgcctcttctc
tttccgtgtggaactatcaaaggagatactcttccaaaaatgctcaaggacaaagggatc
cccatggaaagcatgcatgtctatcagacagttccacaccctgggatccaagggagcctg
aagagctactatgaagatcagggtatcccagccagcatcacgtttttcagtccctccggc
cttaaatacagcctcgagtatattcaggcgttatctggcagcagctttgaccagattaag
tttatagccattggccccagtacaacccgtgctatggctgctaagggcctgcctgtgagc
tgcactgcagagagccccacaccacaagccctggctgcaggcatcaggaatgtgctgaag
ccaaaccactgttgctga

DBGET integrated database retrieval system